Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | AAC767_RS02055 | Genome accession | NZ_CP151209 |
| Coordinates | 400317..400592 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain DJH702 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 356081..418697 | 400317..400592 | within | 0 |
Gene organization within MGE regions
Location: 356081..418697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAC767_RS01750 (AAC767_01740) | - | 356081..357088 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| AAC767_RS01755 (AAC767_01745) | comGG | 357217..357570 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| AAC767_RS01760 (AAC767_01750) | comGF | 357570..358004 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| AAC767_RS01765 (AAC767_01755) | - | 357994..358320 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| AAC767_RS01770 (AAC767_01760) | hemH | 359122..360063 (-) | 942 | WP_033606971.1 | ferrochelatase | - |
| AAC767_RS01780 (AAC767_01770) | - | 360779..361051 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| AAC767_RS01785 (AAC767_01775) | - | 361123..361323 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| AAC767_RS01790 (AAC767_01780) | - | 362188..363429 (-) | 1242 | WP_002392204.1 | LysM peptidoglycan-binding domain-containing protein | - |
| AAC767_RS01795 (AAC767_01785) | - | 363430..363663 (-) | 234 | WP_002384371.1 | phage holin | - |
| AAC767_RS01800 (AAC767_01790) | - | 363656..363877 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| AAC767_RS01805 (AAC767_01795) | - | 363912..364067 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| AAC767_RS01810 (AAC767_01800) | - | 364069..364389 (-) | 321 | WP_010774127.1 | hypothetical protein | - |
| AAC767_RS01815 (AAC767_01805) | - | 364403..364894 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| AAC767_RS01820 (AAC767_01810) | - | 364894..365181 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| AAC767_RS01825 (AAC767_01815) | - | 365178..365774 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| AAC767_RS01830 (AAC767_01820) | - | 365767..366648 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| AAC767_RS01835 (AAC767_01825) | - | 366667..369474 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| AAC767_RS01840 (AAC767_01830) | - | 369456..370190 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| AAC767_RS01845 (AAC767_01835) | - | 370180..373077 (-) | 2898 | WP_002392207.1 | tape measure protein | - |
| AAC767_RS01850 (AAC767_01840) | gpG | 373325..373675 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| AAC767_RS01855 (AAC767_01845) | - | 373728..374576 (-) | 849 | WP_002384363.1 | major tail protein | - |
| AAC767_RS01860 (AAC767_01850) | - | 374577..374951 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| AAC767_RS01865 (AAC767_01855) | - | 374954..375298 (-) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| AAC767_RS01870 (AAC767_01860) | - | 375652..376902 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| AAC767_RS01875 (AAC767_01865) | - | 377040..377123 (-) | 84 | Protein_372 | HK97 gp10 family phage protein | - |
| AAC767_RS01880 (AAC767_01870) | - | 377116..377484 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| AAC767_RS01885 (AAC767_01875) | - | 377481..377825 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| AAC767_RS01890 (AAC767_01880) | - | 377839..378021 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| AAC767_RS01895 (AAC767_01885) | - | 378050..378937 (-) | 888 | WP_002392257.1 | DUF5309 domain-containing protein | - |
| AAC767_RS01900 (AAC767_01890) | - | 378951..379574 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| AAC767_RS01905 (AAC767_01895) | - | 379792..380112 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| AAC767_RS01910 (AAC767_01900) | - | 380177..380398 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| AAC767_RS01915 (AAC767_01905) | - | 380395..382152 (-) | 1758 | WP_002392258.1 | head protein | - |
| AAC767_RS01920 (AAC767_01910) | - | 382127..383614 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| AAC767_RS01925 (AAC767_01915) | - | 383626..384915 (-) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| AAC767_RS01930 (AAC767_01920) | terS | 384887..385690 (-) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| AAC767_RS01935 (AAC767_01925) | - | 385737..386459 (-) | 723 | WP_002392259.1 | DUF5677 domain-containing protein | - |
| AAC767_RS01940 (AAC767_01930) | - | 387176..387790 (-) | 615 | WP_002384355.1 | hypothetical protein | - |
| AAC767_RS01950 (AAC767_01940) | - | 388321..388737 (-) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AAC767_RS01955 (AAC767_01945) | - | 389644..390067 (-) | 424 | Protein_387 | RusA family crossover junction endodeoxyribonuclease | - |
| AAC767_RS01960 (AAC767_01950) | - | 390085..390384 (-) | 300 | WP_002392260.1 | MazG-like family protein | - |
| AAC767_RS01965 (AAC767_01955) | - | 390385..390687 (-) | 303 | WP_002364215.1 | hypothetical protein | - |
| AAC767_RS01970 (AAC767_01960) | - | 390691..391653 (-) | 963 | WP_002392261.1 | Lin1244/Lin1753 domain-containing protein | - |
| AAC767_RS01975 (AAC767_01965) | - | 391667..392557 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| AAC767_RS01980 (AAC767_01970) | - | 392560..393501 (-) | 942 | WP_002364219.1 | YqaJ viral recombinase family protein | - |
| AAC767_RS01985 (AAC767_01975) | - | 393599..393826 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| AAC767_RS01990 (AAC767_01980) | - | 393826..394149 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| AAC767_RS01995 (AAC767_01985) | - | 394193..394378 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| AAC767_RS02000 (AAC767_01990) | - | 394369..394563 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| AAC767_RS02005 (AAC767_01995) | - | 394616..394798 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| AAC767_RS02010 (AAC767_02000) | - | 394838..395560 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| AAC767_RS02015 (AAC767_02005) | - | 395599..395916 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| AAC767_RS02020 (AAC767_02010) | - | 395922..396113 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| AAC767_RS02025 (AAC767_02015) | - | 396404..396748 (+) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| AAC767_RS02030 (AAC767_02020) | - | 396753..397400 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AAC767_RS02035 (AAC767_02025) | - | 397518..398282 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| AAC767_RS02040 (AAC767_02030) | - | 398297..398626 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| AAC767_RS02045 (AAC767_02035) | - | 398701..399849 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| AAC767_RS02050 (AAC767_02040) | comGD | 399877..400320 (-) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| AAC767_RS02055 (AAC767_02045) | comGC/cglC | 400317..400592 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AAC767_RS02060 (AAC767_02050) | comGB | 400592..401638 (-) | 1047 | WP_002384344.1 | competence type IV pilus assembly protein ComGB | - |
| AAC767_RS02065 (AAC767_02055) | comGA | 401595..402563 (-) | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
| AAC767_RS02070 (AAC767_02060) | - | 402804..404132 (-) | 1329 | WP_002384343.1 | APC family permease | - |
| AAC767_RS02075 (AAC767_02065) | rlmN | 404422..405495 (-) | 1074 | WP_002384342.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| AAC767_RS02080 (AAC767_02070) | - | 405619..407448 (-) | 1830 | WP_002384340.1 | ABC transporter permease | - |
| AAC767_RS02085 (AAC767_02075) | - | 407438..408187 (-) | 750 | WP_002384339.1 | ABC transporter ATP-binding protein | - |
| AAC767_RS02090 (AAC767_02080) | - | 408305..409006 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| AAC767_RS02095 (AAC767_02085) | - | 409137..411560 (-) | 2424 | WP_002362065.1 | DNA translocase FtsK | - |
| AAC767_RS02100 (AAC767_02090) | - | 411874..413085 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| AAC767_RS02105 (AAC767_02095) | - | 413114..414019 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| AAC767_RS02110 (AAC767_02100) | - | 414141..415121 (+) | 981 | WP_002388220.1 | polyprenyl synthetase family protein | - |
| AAC767_RS02115 (AAC767_02105) | cydC | 415201..416967 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| AAC767_RS02120 (AAC767_02110) | cydD | 416964..418697 (-) | 1734 | WP_002364247.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=975829 AAC767_RS02055 WP_002364235.1 400317..400592(-) (comGC/cglC) [Enterococcus faecalis strain DJH702]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=975829 AAC767_RS02055 WP_002364235.1 400317..400592(-) (comGC/cglC) [Enterococcus faecalis strain DJH702]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |