Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACKAX6_RS07445 | Genome accession | NZ_CP179215 |
| Coordinates | 1570452..1570763 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain YNSA7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1565452..1575763
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACKAX6_RS07410 (ACKAX6_07410) | gcvPA | 1565954..1567300 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| ACKAX6_RS07415 (ACKAX6_07415) | gcvT | 1567320..1568411 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACKAX6_RS07420 (ACKAX6_07420) | - | 1568570..1569094 (-) | 525 | WP_001015116.1 | shikimate kinase | - |
| ACKAX6_RS07425 (ACKAX6_07425) | - | 1569084..1569230 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACKAX6_RS07430 (ACKAX6_07430) | comGF | 1569327..1569824 (-) | 498 | WP_001838632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACKAX6_RS07435 (ACKAX6_07435) | comGE | 1569742..1570041 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACKAX6_RS07440 (ACKAX6_07440) | comGD | 1570028..1570474 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACKAX6_RS07445 (ACKAX6_07445) | comGC | 1570452..1570763 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACKAX6_RS07450 (ACKAX6_07450) | comGB | 1570777..1571847 (-) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACKAX6_RS07455 (ACKAX6_07455) | comGA | 1571819..1572793 (-) | 975 | WP_000697218.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACKAX6_RS07460 (ACKAX6_07460) | - | 1572845..1573468 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACKAX6_RS07465 (ACKAX6_07465) | - | 1573465..1573794 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACKAX6_RS07470 (ACKAX6_07470) | - | 1573794..1574780 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| ACKAX6_RS07475 (ACKAX6_07475) | - | 1574777..1574980 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=973674 ACKAX6_RS07445 WP_000472256.1 1570452..1570763(-) (comGC) [Staphylococcus aureus strain YNSA7]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=973674 ACKAX6_RS07445 WP_000472256.1 1570452..1570763(-) (comGC) [Staphylococcus aureus strain YNSA7]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |