Detailed information
Bioinformatically predicted
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | WKI52_RS02790 | Genome accession | NZ_CP149646 |
| Coordinates | 551201..551542 (-) | Length | 113 a.a. |
| NCBI ID | WP_003151249.1 | Uniprot ID | A0A9Q3LHX6 |
| Organism | Bacillus velezensis strain MJ06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 543562..561497 | 551201..551542 | within | 0 |
Gene organization within MGE regions
Location: 543562..561497
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WKI52_RS02760 (WKI52_02760) | - | 543562..544308 (-) | 747 | WP_017418762.1 | Wzz/FepE/Etk N-terminal domain-containing protein | - |
| WKI52_RS02765 (WKI52_02765) | - | 544524..544667 (-) | 144 | WP_003151259.1 | hypothetical protein | - |
| WKI52_RS02770 (WKI52_02770) | - | 544871..546481 (+) | 1611 | WP_015418391.1 | SWIM zinc finger family protein | - |
| WKI52_RS02775 (WKI52_02775) | - | 546468..549241 (+) | 2774 | Protein_540 | DEAD/DEAH box helicase | - |
| WKI52_RS02780 (WKI52_02780) | - | 549355..550212 (-) | 858 | WP_025649370.1 | Cof-type HAD-IIB family hydrolase | - |
| WKI52_RS02785 (WKI52_02785) | - | 550209..550991 (-) | 783 | WP_003151250.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| WKI52_RS02790 (WKI52_02790) | ssbB | 551201..551542 (-) | 342 | WP_003151249.1 | single-stranded DNA-binding protein | Machinery gene |
| WKI52_RS02795 (WKI52_02795) | - | 551640..551993 (-) | 354 | WP_003151247.1 | hypothetical protein | - |
| WKI52_RS02800 (WKI52_02800) | - | 552166..552576 (+) | 411 | WP_007407558.1 | YwpF-like family protein | - |
| WKI52_RS02805 (WKI52_02805) | mscL | 552622..553017 (-) | 396 | WP_014419073.1 | large conductance mechanosensitive channel protein MscL | - |
| WKI52_RS02810 (WKI52_02810) | fabZ | 553074..553499 (-) | 426 | WP_003151242.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| WKI52_RS02815 (WKI52_02815) | - | 553695..554759 (+) | 1065 | WP_017418759.1 | tetratricopeptide repeat protein | - |
| WKI52_RS02820 (WKI52_02820) | - | 554777..555598 (-) | 822 | WP_014419076.1 | flagellar hook-basal body protein | - |
| WKI52_RS02825 (WKI52_02825) | - | 555623..556420 (-) | 798 | WP_007614310.1 | flagellar hook-basal body protein | - |
| WKI52_RS02830 (WKI52_02830) | mbl | 556580..557581 (-) | 1002 | WP_003151237.1 | cell shape-determining protein Mbl | - |
| WKI52_RS02835 (WKI52_02835) | spoIIID | 557761..558042 (-) | 282 | WP_003151236.1 | sporulation transcriptional regulator SpoIIID | - |
| WKI52_RS02840 (WKI52_02840) | - | 558374..558787 (+) | 414 | WP_007407562.1 | MarR family transcriptional regulator | - |
| WKI52_RS02845 (WKI52_02845) | - | 558812..560007 (+) | 1196 | Protein_554 | MFS transporter | - |
| WKI52_RS02850 (WKI52_02850) | - | 560043..561497 (-) | 1455 | WP_014419078.1 | NCS1 family nucleobase:cation symporter-1 | - |
Sequence
Protein
Download Length: 113 a.a. Molecular weight: 12661.53 Da Isoelectric Point: 9.5812
>NTDB_id=960183 WKI52_RS02790 WP_003151249.1 551201..551542(-) (ssbB) [Bacillus velezensis strain MJ06]
MFNHVMLVGRLTKDPELRFTSAGIPVAHITLAVNRNFKSASGETGTDFVNCTIWRKNAENTALYCQKGSMVGVSGRIQTR
SYEKTDGVKVYVTEVMADTVRFMDQKRKEPLAE
MFNHVMLVGRLTKDPELRFTSAGIPVAHITLAVNRNFKSASGETGTDFVNCTIWRKNAENTALYCQKGSMVGVSGRIQTR
SYEKTDGVKVYVTEVMADTVRFMDQKRKEPLAE
Nucleotide
Download Length: 342 bp
>NTDB_id=960183 WKI52_RS02790 WP_003151249.1 551201..551542(-) (ssbB) [Bacillus velezensis strain MJ06]
TTGTTTAACCACGTTATGCTTGTCGGCCGGCTGACGAAAGATCCGGAGCTCCGTTTTACATCAGCGGGCATTCCCGTCGC
GCATATTACGTTGGCGGTAAACCGCAATTTTAAAAGCGCGTCGGGTGAAACCGGAACCGACTTCGTCAACTGCACCATCT
GGAGAAAAAACGCTGAAAACACGGCATTGTACTGCCAAAAAGGGTCAATGGTCGGTGTAAGCGGCAGAATCCAGACGAGA
AGCTATGAAAAGACAGACGGCGTAAAAGTTTATGTGACCGAGGTCATGGCTGATACCGTTCGGTTTATGGATCAGAAACG
GAAAGAGCCGCTGGCTGAATAG
TTGTTTAACCACGTTATGCTTGTCGGCCGGCTGACGAAAGATCCGGAGCTCCGTTTTACATCAGCGGGCATTCCCGTCGC
GCATATTACGTTGGCGGTAAACCGCAATTTTAAAAGCGCGTCGGGTGAAACCGGAACCGACTTCGTCAACTGCACCATCT
GGAGAAAAAACGCTGAAAACACGGCATTGTACTGCCAAAAAGGGTCAATGGTCGGTGTAAGCGGCAGAATCCAGACGAGA
AGCTATGAAAAGACAGACGGCGTAAAAGTTTATGTGACCGAGGTCATGGCTGATACCGTTCGGTTTATGGATCAGAAACG
GAAAGAGCCGCTGGCTGAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
76.991 |
100 |
0.77 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
93.805 |
0.54 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.83 |
93.805 |
0.496 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.903 |
100 |
0.469 |
| ssbA | Streptococcus mutans UA159 |
42.478 |
100 |
0.425 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.593 |
100 |
0.416 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.593 |
100 |
0.416 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.708 |
100 |
0.407 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.708 |
100 |
0.407 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.708 |
100 |
0.407 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.708 |
100 |
0.407 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
37.5 |
99.115 |
0.372 |