Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | WDV77_RS08965 | Genome accession | NZ_CP147728 |
| Coordinates | 1810683..1810958 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfaR132 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1771172..1829065 | 1810683..1810958 | within | 0 |
Gene organization within MGE regions
Location: 1771172..1829065
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WDV77_RS08690 (WDV77_08690) | - | 1771172..1772179 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| WDV77_RS08695 (WDV77_08695) | comGG | 1772308..1772661 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| WDV77_RS08700 (WDV77_08700) | comGF | 1772661..1773095 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| WDV77_RS08705 (WDV77_08705) | - | 1773085..1773411 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| WDV77_RS08710 (WDV77_08710) | hemH | 1774212..1775153 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| WDV77_RS08720 (WDV77_08720) | - | 1775869..1776141 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| WDV77_RS08725 (WDV77_08725) | - | 1776213..1776413 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| WDV77_RS08730 (WDV77_08730) | - | 1777266..1778525 (-) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| WDV77_RS08735 (WDV77_08735) | - | 1778538..1778918 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| WDV77_RS08740 (WDV77_08740) | - | 1778929..1779051 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| WDV77_RS08745 (WDV77_08745) | - | 1779053..1779448 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| WDV77_RS08750 (WDV77_08750) | - | 1779467..1779919 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| WDV77_RS08755 (WDV77_08755) | - | 1779936..1780676 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| WDV77_RS08760 (WDV77_08760) | - | 1780682..1782127 (-) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| WDV77_RS08765 (WDV77_08765) | - | 1782127..1782849 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| WDV77_RS08770 (WDV77_08770) | - | 1782846..1787300 (-) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| WDV77_RS08775 (WDV77_08775) | - | 1787287..1787592 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| WDV77_RS08780 (WDV77_08780) | - | 1787661..1788059 (-) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| WDV77_RS08785 (WDV77_08785) | - | 1788113..1788685 (-) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| WDV77_RS08790 (WDV77_08790) | - | 1788734..1788916 (-) | 183 | WP_002378453.1 | hypothetical protein | - |
| WDV77_RS08795 (WDV77_08795) | - | 1788919..1789524 (-) | 606 | WP_338775170.1 | phage major tail protein, TP901-1 family | - |
| WDV77_RS08800 (WDV77_08800) | - | 1789543..1789935 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| WDV77_RS08805 (WDV77_08805) | - | 1789932..1790270 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WDV77_RS08810 (WDV77_08810) | - | 1790267..1790542 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| WDV77_RS08815 (WDV77_08815) | - | 1790539..1790871 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| WDV77_RS08820 (WDV77_08820) | - | 1790942..1791838 (-) | 897 | WP_002378455.1 | hypothetical protein | - |
| WDV77_RS08825 (WDV77_08825) | - | 1791852..1792487 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| WDV77_RS08830 (WDV77_08830) | - | 1792610..1793536 (-) | 927 | WP_002378457.1 | minor capsid protein | - |
| WDV77_RS08835 (WDV77_08835) | - | 1793529..1795013 (-) | 1485 | WP_002378458.1 | phage portal protein | - |
| WDV77_RS08840 (WDV77_08840) | - | 1795013..1796296 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| WDV77_RS08845 (WDV77_08845) | - | 1796277..1796711 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| WDV77_RS08850 (WDV77_08850) | - | 1796743..1796973 (-) | 231 | Protein_1713 | hypothetical protein | - |
| WDV77_RS08855 (WDV77_08855) | - | 1797444..1797806 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| WDV77_RS08860 (WDV77_08860) | - | 1797923..1798831 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| WDV77_RS08870 (WDV77_08870) | - | 1799546..1799962 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WDV77_RS08875 (WDV77_08875) | - | 1800870..1801277 (-) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WDV77_RS08880 (WDV77_08880) | - | 1801274..1802131 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| WDV77_RS08885 (WDV77_08885) | - | 1802131..1802331 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| WDV77_RS08890 (WDV77_08890) | - | 1802336..1802977 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| WDV77_RS08895 (WDV77_08895) | - | 1802982..1803716 (-) | 735 | WP_002378463.1 | ERF family protein | - |
| WDV77_RS08900 (WDV77_08900) | - | 1803709..1804026 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| WDV77_RS08905 (WDV77_08905) | - | 1804246..1804800 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| WDV77_RS08910 (WDV77_08910) | - | 1805227..1805421 (-) | 195 | WP_002378464.1 | hypothetical protein | - |
| WDV77_RS08915 (WDV77_08915) | - | 1805458..1805667 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| WDV77_RS08920 (WDV77_08920) | - | 1805722..1805910 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| WDV77_RS08925 (WDV77_08925) | - | 1805936..1806661 (-) | 726 | WP_002378466.1 | phage regulatory protein | - |
| WDV77_RS08930 (WDV77_08930) | - | 1806700..1807011 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| WDV77_RS08935 (WDV77_08935) | - | 1807022..1807198 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| WDV77_RS08940 (WDV77_08940) | - | 1807510..1807842 (+) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| WDV77_RS08945 (WDV77_08945) | - | 1807859..1808203 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| WDV77_RS08950 (WDV77_08950) | - | 1808239..1808967 (+) | 729 | WP_002378468.1 | potassium channel family protein | - |
| WDV77_RS08955 (WDV77_08955) | - | 1809067..1810215 (+) | 1149 | WP_002378469.1 | site-specific integrase | - |
| WDV77_RS08960 (WDV77_08960) | comGD | 1810252..1810686 (-) | 435 | Protein_1734 | competence type IV pilus minor pilin ComGD | - |
| WDV77_RS08965 (WDV77_08965) | comGC/cglC | 1810683..1810958 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WDV77_RS08970 (WDV77_08970) | comGB | 1810958..1812004 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| WDV77_RS08975 (WDV77_08975) | comGA | 1811961..1812929 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| WDV77_RS08980 (WDV77_08980) | - | 1813170..1814498 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| WDV77_RS08985 (WDV77_08985) | rlmN | 1814788..1815861 (-) | 1074 | WP_002378471.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| WDV77_RS08990 (WDV77_08990) | - | 1815987..1817816 (-) | 1830 | WP_002401809.1 | ABC transporter permease | - |
| WDV77_RS08995 (WDV77_08995) | - | 1817806..1818555 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| WDV77_RS09000 (WDV77_09000) | - | 1818673..1819374 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| WDV77_RS09005 (WDV77_09005) | - | 1819505..1821928 (-) | 2424 | WP_002378474.1 | DNA translocase FtsK | - |
| WDV77_RS09010 (WDV77_09010) | - | 1822242..1823453 (-) | 1212 | WP_002378475.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| WDV77_RS09015 (WDV77_09015) | - | 1823482..1824387 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| WDV77_RS09020 (WDV77_09020) | - | 1824509..1825489 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| WDV77_RS09025 (WDV77_09025) | cydC | 1825569..1827335 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| WDV77_RS09030 (WDV77_09030) | cydD | 1827332..1829065 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=948283 WDV77_RS08965 WP_002356991.1 1810683..1810958(-) (comGC/cglC) [Enterococcus faecalis strain EfaR132]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=948283 WDV77_RS08965 WP_002356991.1 1810683..1810958(-) (comGC/cglC) [Enterococcus faecalis strain EfaR132]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |