Detailed information NTG0940874

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: V6U70_RS09305
• Genome accession: NZ_CP145868
• Coordinates: 2008917..2009231 (-)
• Length: 104 a.a.
• NCBI ID: WP_170314557.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain KSS12
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2003917..2014231

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U70_RS09265 (V6U70_09260)	-	2004181..2004837 (-)	657	WP_410532390.1	CPBP family intramembrane glutamic endopeptidase	-
V6U70_RS09270 (V6U70_09265)	-	2004849..2005046 (-)	198	WP_014635114.1	helix-turn-helix transcriptional regulator	-
V6U70_RS09275 (V6U70_09270)	-	2005297..2006490 (-)	1194	WP_014635115.1	acetate kinase	-
V6U70_RS09280 (V6U70_09275)	comYH	2006547..2007503 (-)	957	WP_002885753.1	class I SAM-dependent methyltransferase	Machinery gene
V6U70_RS09285 (V6U70_09280)	comGG	2007548..2007865 (-)	318	WP_021144683.1	competence type IV pilus minor pilin ComGG	-
V6U70_RS09290 (V6U70_09285)	comYF	2007843..2008280 (-)	438	WP_021144684.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U70_RS09295 (V6U70_09290)	comGE	2008267..2008497 (-)	231	WP_002887015.1	competence type IV pilus minor pilin ComGE	-
V6U70_RS09300 (V6U70_09295)	comYD	2008529..2008957 (-)	429	WP_254593949.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U70_RS09305 (V6U70_09300)	comYC	2008917..2009231 (-)	315	WP_170314557.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U70_RS09310 (V6U70_09305)	comYB	2009240..2010340 (-)	1101	WP_410533115.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U70_RS09315 (V6U70_09310)	comYA	2010222..2011163 (-)	942	WP_410532391.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U70_RS09320 (V6U70_09315)	-	2011243..2011605 (-)	363	WP_002885749.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11442.38 Da
• Isoelectric Point: 9.9219

>NTDB_id=940874 V6U70_RS09305 WP_170314557.1 2008917..2009231(-) (comYC) [Streptococcus salivarius strain KSS12]
MKKLKAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI
TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 315 bp

>NTDB_id=940874 V6U70_RS09305 WP_170314557.1 2008917..2009231(-) (comYC) [Streptococcus salivarius strain KSS12]
TTGAAAAAATTGAAGGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT
CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG
TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC
ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGTTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	71.154	100	0.712
comYC	Streptococcus mutans UA159	71.154	100	0.712
comYC	Streptococcus gordonii str. Challis substr. CH1	65.714	100	0.663
comGC/cglC	Streptococcus mitis SK321	64.646	95.192	0.615
comGC/cglC	Streptococcus pneumoniae TIGR4	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae D39	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae Rx1	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae R6	59.804	98.077	0.587
comGC/cglC	Streptococcus mitis NCTC 12261	60.396	97.115	0.587
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375