Detailed information NTG0938382

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: V6C74_RS06280
• Genome accession: NZ_CP145263
• Coordinates: 1239075..1239386 (+)
• Length: 103 a.a.
• NCBI ID: WP_029625707.1
• Uniprot ID: -
• Organism: Staphylococcus capitis subsp. capitis strain DSM 20326
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1234075..1244386

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6C74_RS06250 (V6C74_06240)	-	1234848..1235051 (+)	204	WP_103175540.1	YqgQ family protein	-
V6C74_RS06255 (V6C74_06245)	-	1235048..1236034 (+)	987	WP_002453336.1	ROK family glucokinase	-
V6C74_RS06260 (V6C74_06250)	-	1236034..1236360 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
V6C74_RS06265 (V6C74_06255)	-	1236360..1236983 (+)	624	WP_002453335.1	MBL fold metallo-hydrolase	-
V6C74_RS06270 (V6C74_06260)	comGA	1237041..1238015 (+)	975	WP_103175541.1	competence type IV pilus ATPase ComGA	Machinery gene
V6C74_RS06275 (V6C74_06265)	comGB	1237987..1239056 (+)	1070	Protein_1169	competence type IV pilus assembly protein ComGB	-
V6C74_RS06280 (V6C74_06270)	comGC	1239075..1239386 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
V6C74_RS06285 (V6C74_06275)	comGD	1239376..1239813 (+)	438	WP_016898188.1	competence type IV pilus minor pilin ComGD	-
V6C74_RS06290 (V6C74_06280)	-	1239800..1240099 (+)	300	WP_002453332.1	hypothetical protein	-
V6C74_RS06295 (V6C74_06285)	-	1240017..1240421 (+)	405	WP_229716900.1	ComGF family competence protein	-
V6C74_RS06300 (V6C74_06290)	-	1240678..1241187 (+)	510	WP_029625706.1	shikimate kinase	-
V6C74_RS06305 (V6C74_06295)	gcvT	1241396..1242487 (+)	1092	WP_016898186.1	glycine cleavage system aminomethyltransferase GcvT	-
V6C74_RS06310 (V6C74_06300)	gcvPA	1242506..1243852 (+)	1347	WP_016898185.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=938382 V6C74_RS06280 WP_029625707.1 1239075..1239386(+) (comGC) [Staphylococcus capitis subsp. capitis strain DSM 20326]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=938382 V6C74_RS06280 WP_029625707.1 1239075..1239386(+) (comGC) [Staphylococcus capitis subsp. capitis strain DSM 20326]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATAATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369