Detailed information NTG0938279

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: V6C94_RS06635
• Genome accession: NZ_CP145253
• Coordinates: 1359280..1359591 (+)
• Length: 103 a.a.
• NCBI ID: WP_367122033.1
• Uniprot ID: -
• Organism: Staphylococcus capitis subsp. urealyticus strain Sc1191106
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1354280..1364591

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6C94_RS06605 (V6C94_06610)	-	1355055..1355258 (+)	204	WP_002433937.1	YqgQ family protein	-
V6C94_RS06610 (V6C94_06615)	-	1355255..1356241 (+)	987	WP_023350198.1	ROK family glucokinase	-
V6C94_RS06615 (V6C94_06620)	-	1356241..1356567 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
V6C94_RS06620 (V6C94_06625)	-	1356567..1357190 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
V6C94_RS06625 (V6C94_06630)	comGA	1357248..1358222 (+)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
V6C94_RS06630 (V6C94_06635)	comGB	1358194..1359261 (+)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
V6C94_RS06635 (V6C94_06640)	comGC	1359280..1359591 (+)	312	WP_367122033.1	competence type IV pilus major pilin ComGC	Machinery gene
V6C94_RS06640 (V6C94_06645)	comGD	1359572..1360018 (+)	447	WP_226859643.1	competence type IV pilus minor pilin ComGD	-
V6C94_RS06645 (V6C94_06650)	-	1360005..1360304 (+)	300	WP_023350203.1	hypothetical protein	-
V6C94_RS06650 (V6C94_06655)	comGF	1360222..1360713 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
V6C94_RS06655 (V6C94_06660)	-	1360883..1361392 (+)	510	WP_029625706.1	shikimate kinase	-
V6C94_RS06660 (V6C94_06665)	gcvT	1361601..1362692 (+)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
V6C94_RS06665 (V6C94_06670)	gcvPA	1362711..1364057 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11403.47 Da
• Isoelectric Point: 9.1831

>NTDB_id=938279 V6C94_RS06635 WP_367122033.1 1359280..1359591(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1191106]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNDEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=938279 V6C94_RS06635 WP_367122033.1 1359280..1359591(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1191106]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGATGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	85.437	100	0.854
comGC	Staphylococcus aureus MW2	85.437	100	0.854
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	48.837	83.495	0.408
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC/cglC	Streptococcus pneumoniae D39	47.674	83.495	0.398
comGC/cglC	Streptococcus pneumoniae Rx1	47.674	83.495	0.398
comGC/cglC	Streptococcus pneumoniae TIGR4	47.674	83.495	0.398
comGC/cglC	Streptococcus pneumoniae R6	47.674	83.495	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379