Detailed information NTG0938244

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: V6C79_RS06435
• Genome accession: NZ_CP145251
• Coordinates: 1327147..1327458 (+)
• Length: 103 a.a.
• NCBI ID: WP_029625707.1
• Uniprot ID: -
• Organism: Staphylococcus capitis subsp. urealyticus strain Sc1365665
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1322147..1332458

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6C79_RS06405 (V6C79_06385)	-	1322922..1323125 (+)	204	WP_002433937.1	YqgQ family protein	-
V6C79_RS06410 (V6C79_06390)	-	1323122..1324108 (+)	987	WP_023350198.1	ROK family glucokinase	-
V6C79_RS06415 (V6C79_06395)	-	1324108..1324434 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
V6C79_RS06420 (V6C79_06400)	-	1324434..1325057 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
V6C79_RS06425 (V6C79_06405)	comGA	1325115..1326089 (+)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
V6C79_RS06430 (V6C79_06410)	comGB	1326061..1327128 (+)	1068	WP_367122040.1	competence type IV pilus assembly protein ComGB	-
V6C79_RS06435 (V6C79_06415)	comGC	1327147..1327458 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
V6C79_RS06440 (V6C79_06420)	comGD	1327436..1327885 (+)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
V6C79_RS06445 (V6C79_06425)	-	1327872..1328171 (+)	300	WP_023350203.1	hypothetical protein	-
V6C79_RS06450 (V6C79_06430)	comGF	1328089..1328580 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
V6C79_RS06455 (V6C79_06435)	-	1328750..1329259 (+)	510	WP_029625706.1	shikimate kinase	-
V6C79_RS06460 (V6C79_06440)	gcvT	1329468..1330559 (+)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
V6C79_RS06465 (V6C79_06445)	gcvPA	1330578..1331924 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=938244 V6C79_RS06435 WP_029625707.1 1327147..1327458(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1365665]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=938244 V6C79_RS06435 WP_029625707.1 1327147..1327458(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1365665]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369