Detailed information NTG0938142

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: V6D01_RS06220
• Genome accession: NZ_CP145244
• Coordinates: 1263977..1264288 (+)
• Length: 103 a.a.
• NCBI ID: WP_367122997.1
• Uniprot ID: -
• Organism: Staphylococcus capitis subsp. urealyticus strain Sc1365670
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1258977..1269288

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6D01_RS06190 (V6D01_06175)	-	1259752..1259955 (+)	204	WP_002433937.1	YqgQ family protein	-
V6D01_RS06195 (V6D01_06180)	-	1259952..1260938 (+)	987	WP_023350198.1	ROK family glucokinase	-
V6D01_RS06200 (V6D01_06185)	-	1260938..1261264 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
V6D01_RS06205 (V6D01_06190)	-	1261264..1261887 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
V6D01_RS06210 (V6D01_06195)	comGA	1261945..1262919 (+)	975	WP_145387902.1	competence type IV pilus ATPase ComGA	Machinery gene
V6D01_RS06215 (V6D01_06200)	comGB	1262891..1263958 (+)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
V6D01_RS06220 (V6D01_06205)	comGC	1263977..1264288 (+)	312	WP_367122997.1	competence type IV pilus major pilin ComGC	Machinery gene
V6D01_RS06225 (V6D01_06210)	comGD	1264266..1264715 (+)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
V6D01_RS06230 (V6D01_06215)	-	1264702..1265001 (+)	300	WP_023350203.1	hypothetical protein	-
V6D01_RS06235 (V6D01_06220)	comGF	1264919..1265410 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
V6D01_RS06240 (V6D01_06225)	-	1265580..1266089 (+)	510	WP_029625706.1	shikimate kinase	-
V6D01_RS06245 (V6D01_06230)	gcvT	1266298..1267389 (+)	1092	WP_367122713.1	glycine cleavage system aminomethyltransferase GcvT	-
V6D01_RS06250 (V6D01_06235)	gcvPA	1267408..1268754 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=938142 V6D01_RS06220 WP_367122997.1 1263977..1264288(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTIKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=938142 V6D01_RS06220 WP_367122997.1 1263977..1264288(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACAATAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	85.437	100	0.854
comGC	Staphylococcus aureus MW2	85.437	100	0.854
comYC	Streptococcus gordonii str. Challis substr. CH1	44.66	100	0.447
comGC/cglC	Streptococcus mitis SK321	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	43.137	99.029	0.427
comGC/cglC	Streptococcus pneumoniae TIGR4	43.137	99.029	0.427
comGC/cglC	Streptococcus pneumoniae Rx1	43.137	99.029	0.427
comGC/cglC	Streptococcus pneumoniae D39	43.137	99.029	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	47.674	83.495	0.398
comYC	Streptococcus mutans UA140	45.455	85.437	0.388
comYC	Streptococcus mutans UA159	45.455	85.437	0.388
comGC	Lactococcus lactis subsp. cremoris KW2	49.367	76.699	0.379
comYC	Streptococcus suis isolate S10	48.718	75.728	0.369