Detailed information NTG0937764

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: V6C56_RS06050
• Genome accession: NZ_CP145208
• Coordinates: 1247436..1247747 (+)
• Length: 103 a.a.
• NCBI ID: WP_029625707.1
• Uniprot ID: -
• Organism: Staphylococcus capitis subsp. urealyticus strain Sc1516939
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1242436..1252747

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6C56_RS06020 (V6C56_06020)	-	1243211..1243414 (+)	204	WP_002433937.1	YqgQ family protein	-
V6C56_RS06025 (V6C56_06025)	-	1243411..1244397 (+)	987	WP_186334168.1	ROK family glucokinase	-
V6C56_RS06030 (V6C56_06030)	-	1244397..1244723 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
V6C56_RS06035 (V6C56_06035)	-	1244723..1245346 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
V6C56_RS06040 (V6C56_06040)	comGA	1245404..1246378 (+)	975	WP_049427590.1	competence type IV pilus ATPase ComGA	Machinery gene
V6C56_RS06045 (V6C56_06045)	comGB	1246350..1247417 (+)	1068	WP_049427592.1	competence type IV pilus assembly protein ComGB	-
V6C56_RS06050 (V6C56_06050)	comGC	1247436..1247747 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
V6C56_RS06055 (V6C56_06055)	comGD	1247725..1248174 (+)	450	WP_162488576.1	competence type IV pilus minor pilin ComGD	-
V6C56_RS06060 (V6C56_06060)	-	1248161..1248460 (+)	300	WP_023350203.1	hypothetical protein	-
V6C56_RS06065 (V6C56_06065)	comGF	1248441..1248869 (+)	429	WP_231098764.1	competence type IV pilus minor pilin ComGF	-
V6C56_RS06070 (V6C56_06070)	-	1249039..1249548 (+)	510	WP_336390744.1	shikimate kinase	-
V6C56_RS06075 (V6C56_06075)	gcvT	1249757..1250848 (+)	1092	WP_037549231.1	glycine cleavage system aminomethyltransferase GcvT	-
V6C56_RS06080 (V6C56_06080)	gcvPA	1250867..1252213 (+)	1347	WP_037549230.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=937764 V6C56_RS06050 WP_029625707.1 1247436..1247747(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1516939]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=937764 V6C56_RS06050 WP_029625707.1 1247436..1247747(+) (comGC) [Staphylococcus capitis subsp. urealyticus strain Sc1516939]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369