NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	V5G22_RS10015	Genome accession	NZ_CP144920
Coordinates	2004615..2004962 (+)	Length	115 a.a.
NCBI ID	WP_003185893.1	Uniprot ID	A0AB37GL97
Organism	Bacillus licheniformis strain CP26
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1999615..2009962

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V5G22_RS09985 (V5G22_09985)	-	2000714..2001553 (+)	840	WP_003185907.1	flagellar hook-basal body protein	-
V5G22_RS09990 (V5G22_09990)	-	2001597..2002424 (+)	828	WP_003185904.1	flagellar hook-basal body protein	-
V5G22_RS09995 (V5G22_09995)	fabZ	2002618..2003052 (+)	435	WP_003185902.1	3-hydroxyacyl-ACP dehydratase FabZ	-
V5G22_RS10000 (V5G22_10000)	mscL	2003122..2003502 (+)	381	WP_003185900.1	large conductance mechanosensitive channel protein MscL	-
V5G22_RS10005 (V5G22_10005)	-	2003543..2003956 (-)	414	WP_003185898.1	YwpF-like family protein	-
V5G22_RS10010 (V5G22_10010)	-	2004138..2004509 (+)	372	WP_003185895.1	hypothetical protein	-
V5G22_RS10015 (V5G22_10015)	ssbB	2004615..2004962 (+)	348	WP_003185893.1	single-stranded DNA-binding protein	Machinery gene
V5G22_RS10020 (V5G22_10020)	-	2005184..2006146 (+)	963	WP_003185891.1	sugar-binding transcriptional regulator	-
V5G22_RS10025 (V5G22_10025)	-	2006143..2006586 (+)	444	WP_003185888.1	transcriptional regulator GutM	-
V5G22_RS10030 (V5G22_10030)	-	2006583..2007131 (+)	549	WP_003185886.1	PTS glucitol/sorbitol transporter subunit IIC	-
V5G22_RS10035 (V5G22_10035)	-	2007149..2008156 (+)	1008	WP_003185884.1	PTS glucitol/sorbitol transporter subunit IIB	-
V5G22_RS10040 (V5G22_10040)	-	2008181..2008552 (+)	372	WP_003185882.1	PTS glucitol/sorbitol transporter subunit IIA	-
V5G22_RS10045 (V5G22_10045)	srlD	2008567..2009352 (+)	786	WP_003185881.1	sorbitol-6-phosphate dehydrogenase	-

Sequence

Protein

Download Length: 115 a.a. Molecular weight: 12753.44 Da Isoelectric Point: 6.9538

                                >NTDB_id=935196 V5G22_RS10015 WP_003185893.1 2004615..2004962(+) (ssbB) [Bacillus licheniformis strain CP26]

MFNEIMLVGRLTKDPELRYTSDGVPVANVTLAVSRPFKNAAGEVEADFVNCTLWRKTAVNTAEYCEKGSIIGLSGRIQTR

QYVNSEGERTFITEVVARSVRFLGESRKAHEPADA

Nucleotide

Download Length: 348 bp

                                >NTDB_id=935196 V5G22_RS10015 WP_003185893.1 2004615..2004962(+) (ssbB) [Bacillus licheniformis strain CP26]

ATGTTTAATGAGATCATGCTCGTCGGGCGTTTGACAAAAGATCCCGAACTGCGGTATACATCTGACGGTGTCCCTGTTGC

AAATGTGACGCTGGCTGTCAGCAGGCCTTTCAAGAACGCAGCAGGCGAAGTAGAAGCGGACTTTGTCAATTGCACTCTAT

GGCGCAAAACTGCCGTGAACACAGCCGAATATTGCGAAAAAGGCTCCATCATCGGGCTGAGCGGAAGAATCCAGACCCGC

CAATACGTCAATTCAGAAGGCGAACGCACCTTTATTACAGAAGTTGTCGCCCGGTCAGTCAGATTTTTGGGAGAAAGCCG

GAAAGCGCATGAGCCGGCTGATGCTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	70.874	89.565	0.635
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.223	89.565	0.53
ssb	Latilactobacillus sakei subsp. sakei 23K	51.351	96.522	0.496
ssbA	Streptococcus mutans UA159	45.794	93.043	0.426
ssbB	Lactococcus lactis subsp. cremoris KW2	44.34	92.174	0.409
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.925	93.043	0.409
ssbB/cilA	Streptococcus mitis NCTC 12261	42.991	93.043	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	42.991	93.043	0.4
ssbB/cilA	Streptococcus pneumoniae Rx1	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae D39	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae R6	42.056	93.043	0.391
ssbB/cilA	Streptococcus mitis SK321	42.056	93.043	0.391

Detailed information NTG0935196