Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | V2I05_RS08995 | Genome accession | NZ_CP143587 |
| Coordinates | 1810317..1810592 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain IDRL-7415 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1768735..1828699 | 1810317..1810592 | within | 0 |
Gene organization within MGE regions
Location: 1768735..1828699
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V2I05_RS08710 | - | 1768735..1769742 (-) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| V2I05_RS08715 | comGG | 1769871..1770224 (-) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| V2I05_RS08720 | comGF | 1770224..1770658 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| V2I05_RS08725 | - | 1770648..1770974 (-) | 327 | WP_002390369.1 | type II secretion system protein | - |
| V2I05_RS08730 | hemH | 1771776..1772717 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| V2I05_RS08740 | - | 1773433..1773705 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| V2I05_RS08745 | - | 1773777..1773977 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| V2I05_RS08750 | - | 1774824..1776083 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| V2I05_RS08755 | - | 1776480..1777730 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| V2I05_RS08760 | - | 1777867..1778247 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| V2I05_RS08765 | - | 1778258..1778380 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| V2I05_RS08770 | - | 1778382..1778777 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| V2I05_RS08775 | - | 1778796..1779248 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| V2I05_RS08780 | - | 1779265..1780005 (-) | 741 | WP_025193093.1 | hypothetical protein | - |
| V2I05_RS08785 | - | 1780011..1781456 (-) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| V2I05_RS08790 | - | 1781456..1782178 (-) | 723 | WP_010785045.1 | hypothetical protein | - |
| V2I05_RS08795 | - | 1782175..1786629 (-) | 4455 | WP_010785046.1 | phage tail tape measure protein | - |
| V2I05_RS08800 | - | 1786616..1786921 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| V2I05_RS08805 | - | 1786990..1787388 (-) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| V2I05_RS08810 | - | 1787451..1787759 (-) | 309 | WP_010785047.1 | hypothetical protein | - |
| V2I05_RS08815 | - | 1787762..1788367 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| V2I05_RS08820 | - | 1788386..1788778 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| V2I05_RS08825 | - | 1788775..1789113 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| V2I05_RS08830 | - | 1789110..1789385 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| V2I05_RS08835 | - | 1789382..1789714 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| V2I05_RS08840 | - | 1789785..1790681 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| V2I05_RS08845 | - | 1790695..1791330 (-) | 636 | WP_260604022.1 | DUF4355 domain-containing protein | - |
| V2I05_RS08850 | - | 1791453..1792379 (-) | 927 | WP_010785048.1 | minor capsid protein | - |
| V2I05_RS08855 | - | 1792372..1793856 (-) | 1485 | WP_010785049.1 | phage portal protein | - |
| V2I05_RS08860 | - | 1793856..1795139 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| V2I05_RS08865 | - | 1795120..1795554 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| V2I05_RS08870 | - | 1795586..1795816 (-) | 231 | Protein_1716 | hypothetical protein | - |
| V2I05_RS08875 | - | 1796287..1796649 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| V2I05_RS08880 | - | 1796766..1797674 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| V2I05_RS08890 | - | 1798389..1798805 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| V2I05_RS08895 | - | 1799712..1800119 (-) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| V2I05_RS08900 | - | 1800116..1800973 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| V2I05_RS08905 | - | 1800973..1801173 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| V2I05_RS08910 | - | 1801178..1801819 (-) | 642 | WP_002357009.1 | putative HNHc nuclease | - |
| V2I05_RS08915 | - | 1801824..1802558 (-) | 735 | WP_002385820.1 | ERF family protein | - |
| V2I05_RS08920 | - | 1802551..1802868 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| V2I05_RS08925 | - | 1803088..1803642 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| V2I05_RS08930 | - | 1803927..1804265 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| V2I05_RS08935 | - | 1804302..1804511 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| V2I05_RS08940 | - | 1804566..1804754 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| V2I05_RS08945 | - | 1804780..1805502 (-) | 723 | WP_002357000.1 | Rha family transcriptional regulator | - |
| V2I05_RS08950 | - | 1805525..1805836 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| V2I05_RS08955 | - | 1805848..1806015 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| V2I05_RS08960 | - | 1806433..1806630 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| V2I05_RS08965 | - | 1806643..1806825 (-) | 183 | WP_002388205.1 | hypothetical protein | - |
| V2I05_RS08970 | - | 1807117..1807452 (+) | 336 | WP_002388206.1 | helix-turn-helix domain-containing protein | - |
| V2I05_RS08975 | - | 1807471..1807815 (+) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| V2I05_RS08980 | - | 1807873..1808601 (+) | 729 | WP_002388208.1 | ion transporter | - |
| V2I05_RS08985 | - | 1808701..1809849 (+) | 1149 | WP_002388210.1 | tyrosine-type recombinase/integrase | - |
| V2I05_RS08990 | comGD | 1809877..1810320 (-) | 444 | WP_016617790.1 | competence type IV pilus minor pilin ComGD | - |
| V2I05_RS08995 | comGC/cglC | 1810317..1810592 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| V2I05_RS09000 | comGB | 1810592..1811638 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| V2I05_RS09005 | comGA | 1811595..1812563 (-) | 969 | WP_002369168.1 | competence type IV pilus ATPase ComGA | - |
| V2I05_RS09010 | - | 1812805..1814133 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| V2I05_RS09015 | rlmN | 1814423..1815496 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| V2I05_RS09020 | - | 1815622..1817451 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| V2I05_RS09025 | - | 1817441..1818190 (-) | 750 | WP_002372053.1 | ABC transporter ATP-binding protein | - |
| V2I05_RS09030 | - | 1818308..1819009 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| V2I05_RS09035 | - | 1819139..1821562 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| V2I05_RS09040 | - | 1821876..1823087 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| V2I05_RS09045 | - | 1823116..1824021 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| V2I05_RS09050 | - | 1824143..1825123 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| V2I05_RS09055 | cydC | 1825203..1826969 (-) | 1767 | WP_002369917.1 | thiol reductant ABC exporter subunit CydC | - |
| V2I05_RS09060 | cydD | 1826966..1828699 (-) | 1734 | WP_002369918.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=929935 V2I05_RS08995 WP_002356991.1 1810317..1810592(-) (comGC/cglC) [Enterococcus faecalis strain IDRL-7415]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=929935 V2I05_RS08995 WP_002356991.1 1810317..1810592(-) (comGC/cglC) [Enterococcus faecalis strain IDRL-7415]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |