NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	V2I03_RS08105	Genome accession	NZ_CP143583
Coordinates	1669520..1669795 (-)	Length	91 a.a.
NCBI ID	WP_002356991.1	Uniprot ID	A0A1B4XPV0
Organism	Enterococcus faecalis strain IDRL-7639
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1664520..1674795

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V2I03_RS08065	-	1664618..1664896 (+)	279	WP_002380425.1	hypothetical protein	-
V2I03_RS08070	-	1665075..1665548 (+)	474	WP_002357065.1	universal stress protein	-
V2I03_RS08075	-	1665660..1666847 (-)	1188	WP_002357064.1	acetate/propionate family kinase	-
V2I03_RS08080	-	1666872..1667879 (-)	1008	WP_033593515.1	class I SAM-dependent methyltransferase	-
V2I03_RS08085	comGG	1668008..1668361 (-)	354	WP_153854185.1	competence type IV pilus minor pilin ComGG	-
V2I03_RS08090	comGF	1668361..1668795 (-)	435	WP_002357060.1	competence type IV pilus minor pilin ComGF	-
V2I03_RS08095	-	1668785..1669111 (-)	327	WP_252671996.1	type II secretion system protein	-
V2I03_RS08100	comGD	1669077..1669523 (-)	447	WP_002366895.1	competence type IV pilus minor pilin ComGD	-
V2I03_RS08105	comGC/cglC	1669520..1669795 (-)	276	WP_002356991.1	competence type IV pilus major pilin ComGC	Machinery gene
V2I03_RS08110	comGB	1669795..1670841 (-)	1047	WP_078127068.1	competence type IV pilus assembly protein ComGB	-
V2I03_RS08115	comGA	1670798..1671766 (-)	969	WP_078127069.1	competence type IV pilus ATPase ComGA	-
V2I03_RS08120	-	1672005..1673333 (-)	1329	WP_173963917.1	APC family permease	-
V2I03_RS08125	rlmN	1673624..1674697 (-)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-

Sequence

Protein

Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192

                                >NTDB_id=929860 V2I03_RS08105 WP_002356991.1 1669520..1669795(-) (comGC/cglC) [Enterococcus faecalis strain IDRL-7639]

MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK

EQLDKYTAEKQ

Nucleotide

Download Length: 276 bp

                                >NTDB_id=929860 V2I03_RS08105 WP_002356991.1 1669520..1669795(-) (comGC/cglC) [Enterococcus faecalis strain IDRL-7639]

ATGAAAAAGAAACAAAAATACGCAGGTTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT

ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTGGAAT

CACAAATCGAGCTCTATACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA

GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-28)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A1B4XPV0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	46.835	86.813	0.407
comGC	Staphylococcus aureus N315	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396

Detailed information NTG0929860