Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW927_RS08990 | Genome accession | NZ_CP142833 |
| Coordinates | 1785106..1785381 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain JF3A-4314 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1748127..1785082 | 1785106..1785381 | flank | 24 |
Gene organization within MGE regions
Location: 1748127..1785381
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW927_RS08685 (VW927_08685) | - | 1748127..1749134 (-) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW927_RS08690 (VW927_08690) | comGG | 1749263..1749616 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW927_RS08695 (VW927_08695) | comGF | 1749616..1750050 (-) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW927_RS08700 (VW927_08700) | - | 1750040..1750411 (-) | 372 | WP_181444836.1 | type II secretion system protein | - |
| VW927_RS08705 (VW927_08705) | - | 1750562..1751647 (-) | 1086 | WP_329443083.1 | SH3 domain-containing protein | - |
| VW927_RS08710 (VW927_08710) | - | 1751652..1751855 (-) | 204 | WP_010711247.1 | phage holin | - |
| VW927_RS08715 (VW927_08715) | - | 1751852..1752073 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| VW927_RS08720 (VW927_08720) | - | 1752101..1752256 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| VW927_RS08725 (VW927_08725) | - | 1752258..1752578 (-) | 321 | WP_329494946.1 | hypothetical protein | - |
| VW927_RS08730 (VW927_08730) | - | 1752589..1753077 (-) | 489 | WP_264547535.1 | hypothetical protein | - |
| VW927_RS08735 (VW927_08735) | - | 1753077..1753394 (-) | 318 | WP_010823170.1 | hypothetical protein | - |
| VW927_RS08740 (VW927_08740) | - | 1753387..1753704 (-) | 318 | WP_264547534.1 | hypothetical protein | - |
| VW927_RS08745 (VW927_08745) | - | 1753701..1754606 (-) | 906 | WP_264547533.1 | phage baseplate upper protein | - |
| VW927_RS08750 (VW927_08750) | - | 1754625..1757420 (-) | 2796 | WP_329443077.1 | phage tail tip lysozyme | - |
| VW927_RS08755 (VW927_08755) | - | 1757417..1758130 (-) | 714 | WP_174123966.1 | phage tail protein | - |
| VW927_RS08760 (VW927_08760) | - | 1758127..1760430 (-) | 2304 | WP_104874255.1 | phage tail tape measure protein | - |
| VW927_RS08765 (VW927_08765) | - | 1760622..1761077 (-) | 456 | WP_002395308.1 | hypothetical protein | - |
| VW927_RS08770 (VW927_08770) | - | 1761077..1761724 (-) | 648 | WP_010784938.1 | major tail protein | - |
| VW927_RS08775 (VW927_08775) | - | 1761721..1762083 (-) | 363 | WP_104858198.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VW927_RS08780 (VW927_08780) | - | 1762073..1762411 (-) | 339 | WP_104858197.1 | hypothetical protein | - |
| VW927_RS08785 (VW927_08785) | - | 1762401..1762727 (-) | 327 | WP_104858196.1 | phage head closure protein | - |
| VW927_RS08790 (VW927_08790) | - | 1762708..1762986 (-) | 279 | WP_002301326.1 | head-tail connector protein | - |
| VW927_RS08795 (VW927_08795) | - | 1762988..1764343 (-) | 1356 | WP_329443055.1 | phage major capsid protein | - |
| VW927_RS08800 (VW927_08800) | - | 1764355..1764927 (-) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| VW927_RS08805 (VW927_08805) | - | 1764914..1766125 (-) | 1212 | WP_029677624.1 | phage portal protein | - |
| VW927_RS08810 (VW927_08810) | - | 1766144..1767871 (-) | 1728 | WP_329443050.1 | terminase large subunit | - |
| VW927_RS08815 (VW927_08815) | - | 1767868..1768320 (-) | 453 | WP_002393034.1 | P27 family phage terminase small subunit | - |
| VW927_RS08820 (VW927_08820) | - | 1768435..1768803 (-) | 369 | WP_064687383.1 | HNH endonuclease | - |
| VW927_RS08825 (VW927_08825) | - | 1768803..1769219 (-) | 417 | WP_002393036.1 | hypothetical protein | - |
| VW927_RS08835 (VW927_08835) | - | 1769748..1770215 (-) | 468 | WP_002380819.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW927_RS08840 (VW927_08840) | - | 1770575..1770781 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| VW927_RS08845 (VW927_08845) | - | 1770795..1771379 (-) | 585 | WP_185776395.1 | DUF3850 domain-containing protein | - |
| VW927_RS08850 (VW927_08850) | - | 1771376..1771555 (-) | 180 | WP_185776396.1 | hypothetical protein | - |
| VW927_RS08855 (VW927_08855) | - | 1771552..1771713 (-) | 162 | WP_010774952.1 | hypothetical protein | - |
| VW927_RS08860 (VW927_08860) | - | 1771710..1772018 (-) | 309 | WP_002380822.1 | hypothetical protein | - |
| VW927_RS08865 (VW927_08865) | - | 1772019..1772393 (-) | 375 | WP_010774953.1 | YopX family protein | - |
| VW927_RS08870 (VW927_08870) | - | 1772437..1773201 (-) | 765 | WP_010785682.1 | DNA-methyltransferase | - |
| VW927_RS08875 (VW927_08875) | - | 1773254..1773460 (-) | 207 | WP_002417547.1 | hypothetical protein | - |
| VW927_RS08880 (VW927_08880) | - | 1773470..1773862 (-) | 393 | WP_185776397.1 | hypothetical protein | - |
| VW927_RS08885 (VW927_08885) | - | 1773868..1774476 (-) | 609 | WP_185776398.1 | hypothetical protein | - |
| VW927_RS08890 (VW927_08890) | - | 1774496..1774966 (-) | 471 | WP_002380828.1 | DUF1064 domain-containing protein | - |
| VW927_RS08895 (VW927_08895) | - | 1775115..1775384 (-) | 270 | WP_185776399.1 | hypothetical protein | - |
| VW927_RS08900 (VW927_08900) | - | 1775523..1776362 (-) | 840 | WP_329443017.1 | ATP-binding protein | - |
| VW927_RS08905 (VW927_08905) | - | 1776374..1777153 (-) | 780 | WP_329443014.1 | DnaD domain protein | - |
| VW927_RS08910 (VW927_08910) | - | 1777168..1777983 (-) | 816 | WP_329443011.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VW927_RS08915 (VW927_08915) | - | 1777946..1778917 (-) | 972 | WP_329443008.1 | RecT family recombinase | - |
| VW927_RS08920 (VW927_08920) | - | 1778992..1779297 (-) | 306 | WP_002395805.1 | hypothetical protein | - |
| VW927_RS08925 (VW927_08925) | - | 1779348..1779602 (+) | 255 | WP_002395804.1 | hypothetical protein | - |
| VW927_RS08930 (VW927_08930) | - | 1779577..1779795 (-) | 219 | WP_002370011.1 | hypothetical protein | - |
| VW927_RS08935 (VW927_08935) | - | 1779899..1780123 (-) | 225 | WP_010821117.1 | hypothetical protein | - |
| VW927_RS08940 (VW927_08940) | - | 1780120..1780443 (-) | 324 | WP_329443002.1 | hypothetical protein | - |
| VW927_RS08945 (VW927_08945) | - | 1780534..1780950 (-) | 417 | WP_329442999.1 | hypothetical protein | - |
| VW927_RS08950 (VW927_08950) | - | 1780951..1781130 (-) | 180 | WP_016627612.1 | hypothetical protein | - |
| VW927_RS08955 (VW927_08955) | - | 1781137..1781448 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| VW927_RS08960 (VW927_08960) | - | 1781459..1781635 (-) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| VW927_RS08965 (VW927_08965) | - | 1781946..1782269 (+) | 324 | WP_010826721.1 | helix-turn-helix domain-containing protein | - |
| VW927_RS08970 (VW927_08970) | - | 1782287..1782631 (+) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW927_RS08975 (VW927_08975) | - | 1782665..1783393 (+) | 729 | WP_002364358.1 | ion transporter | - |
| VW927_RS08980 (VW927_08980) | - | 1783490..1784638 (+) | 1149 | WP_002395797.1 | tyrosine-type recombinase/integrase | - |
| VW927_RS08985 (VW927_08985) | comGD | 1784666..1785109 (-) | 444 | WP_002395796.1 | competence type IV pilus minor pilin ComGD | - |
| VW927_RS08990 (VW927_08990) | comGC/cglC | 1785106..1785381 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927291 VW927_RS08990 WP_002356991.1 1785106..1785381(-) (comGC/cglC) [Enterococcus faecalis strain JF3A-4314]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927291 VW927_RS08990 WP_002356991.1 1785106..1785381(-) (comGC/cglC) [Enterococcus faecalis strain JF3A-4314]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |