Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW924_RS08695 | Genome accession | NZ_CP142831 |
| Coordinates | 1751163..1751438 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain JF4A-2234 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1746163..1756438
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW924_RS08655 (VW924_08655) | - | 1746208..1746540 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| VW924_RS08660 (VW924_08660) | - | 1746718..1747191 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| VW924_RS08665 (VW924_08665) | - | 1747303..1748490 (-) | 1188 | WP_002398460.1 | acetate/propionate family kinase | - |
| VW924_RS08670 (VW924_08670) | - | 1748515..1749522 (-) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW924_RS08675 (VW924_08675) | comGG | 1749651..1750004 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW924_RS08680 (VW924_08680) | comGF | 1750004..1750438 (-) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW924_RS08685 (VW924_08685) | - | 1750428..1750754 (-) | 327 | WP_002425755.1 | type II secretion system protein | - |
| VW924_RS08690 (VW924_08690) | comGD | 1750720..1751166 (-) | 447 | WP_002360025.1 | competence type IV pilus minor pilin ComGD | - |
| VW924_RS08695 (VW924_08695) | comGC/cglC | 1751163..1751438 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW924_RS08700 (VW924_08700) | comGB | 1751438..1752484 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| VW924_RS08705 (VW924_08705) | comGA | 1752441..1753409 (-) | 969 | WP_002398077.1 | competence type IV pilus ATPase ComGA | - |
| VW924_RS08710 (VW924_08710) | - | 1753651..1754979 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| VW924_RS08715 (VW924_08715) | rlmN | 1755269..1756342 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927255 VW924_RS08695 WP_002356991.1 1751163..1751438(-) (comGC/cglC) [Enterococcus faecalis strain JF4A-2234]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927255 VW924_RS08695 WP_002356991.1 1751163..1751438(-) (comGC/cglC) [Enterococcus faecalis strain JF4A-2234]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |