Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW928_RS08430 | Genome accession | NZ_CP142829 |
| Coordinates | 1713405..1713680 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CF2A-2143 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1708405..1718680
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW928_RS08390 (VW928_08390) | - | 1708450..1708782 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| VW928_RS08395 (VW928_08395) | - | 1708960..1709433 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| VW928_RS08400 (VW928_08400) | - | 1709545..1710732 (-) | 1188 | WP_002398460.1 | acetate/propionate family kinase | - |
| VW928_RS08405 (VW928_08405) | - | 1710757..1711764 (-) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW928_RS08410 (VW928_08410) | comGG | 1711893..1712246 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW928_RS08415 (VW928_08415) | comGF | 1712246..1712680 (-) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW928_RS08420 (VW928_08420) | - | 1712670..1712996 (-) | 327 | WP_002425755.1 | type II secretion system protein | - |
| VW928_RS08425 (VW928_08425) | comGD | 1712962..1713408 (-) | 447 | WP_002360025.1 | competence type IV pilus minor pilin ComGD | - |
| VW928_RS08430 (VW928_08430) | comGC/cglC | 1713405..1713680 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW928_RS08435 (VW928_08435) | comGB | 1713680..1714726 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| VW928_RS08440 (VW928_08440) | comGA | 1714683..1715651 (-) | 969 | WP_002398077.1 | competence type IV pilus ATPase ComGA | - |
| VW928_RS08445 (VW928_08445) | - | 1715893..1717221 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| VW928_RS08450 (VW928_08450) | rlmN | 1717511..1718584 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927219 VW928_RS08430 WP_002356991.1 1713405..1713680(-) (comGC/cglC) [Enterococcus faecalis strain CF2A-2143]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927219 VW928_RS08430 WP_002356991.1 1713405..1713680(-) (comGC/cglC) [Enterococcus faecalis strain CF2A-2143]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |