Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW923_RS08975 | Genome accession | NZ_CP142827 |
| Coordinates | 1785075..1785350 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CF4A-3113 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1748096..1785051 | 1785075..1785350 | flank | 24 |
Gene organization within MGE regions
Location: 1748096..1785350
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW923_RS08670 (VW923_08670) | - | 1748096..1749103 (-) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW923_RS08675 (VW923_08675) | comGG | 1749232..1749585 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW923_RS08680 (VW923_08680) | comGF | 1749585..1750019 (-) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW923_RS08685 (VW923_08685) | - | 1750009..1750380 (-) | 372 | WP_181444836.1 | type II secretion system protein | - |
| VW923_RS08690 (VW923_08690) | - | 1750531..1751616 (-) | 1086 | WP_329443083.1 | SH3 domain-containing protein | - |
| VW923_RS08695 (VW923_08695) | - | 1751621..1751824 (-) | 204 | WP_010711247.1 | phage holin | - |
| VW923_RS08700 (VW923_08700) | - | 1751821..1752042 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| VW923_RS08705 (VW923_08705) | - | 1752070..1752225 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| VW923_RS08710 (VW923_08710) | - | 1752227..1752547 (-) | 321 | WP_329494946.1 | hypothetical protein | - |
| VW923_RS08715 (VW923_08715) | - | 1752558..1753046 (-) | 489 | WP_264547535.1 | hypothetical protein | - |
| VW923_RS08720 (VW923_08720) | - | 1753046..1753363 (-) | 318 | WP_010823170.1 | hypothetical protein | - |
| VW923_RS08725 (VW923_08725) | - | 1753356..1753673 (-) | 318 | WP_264547534.1 | hypothetical protein | - |
| VW923_RS08730 (VW923_08730) | - | 1753670..1754575 (-) | 906 | WP_264547533.1 | phage baseplate upper protein | - |
| VW923_RS08735 (VW923_08735) | - | 1754594..1757389 (-) | 2796 | WP_329443077.1 | phage tail tip lysozyme | - |
| VW923_RS08740 (VW923_08740) | - | 1757386..1758099 (-) | 714 | WP_174123966.1 | phage tail protein | - |
| VW923_RS08745 (VW923_08745) | - | 1758096..1760399 (-) | 2304 | WP_104874255.1 | phage tail tape measure protein | - |
| VW923_RS08750 (VW923_08750) | - | 1760591..1761046 (-) | 456 | WP_002395308.1 | hypothetical protein | - |
| VW923_RS08755 (VW923_08755) | - | 1761046..1761693 (-) | 648 | WP_010784938.1 | major tail protein | - |
| VW923_RS08760 (VW923_08760) | - | 1761690..1762052 (-) | 363 | WP_104858198.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VW923_RS08765 (VW923_08765) | - | 1762042..1762380 (-) | 339 | WP_104858197.1 | hypothetical protein | - |
| VW923_RS08770 (VW923_08770) | - | 1762370..1762696 (-) | 327 | WP_104858196.1 | phage head closure protein | - |
| VW923_RS08775 (VW923_08775) | - | 1762677..1762955 (-) | 279 | WP_002301326.1 | head-tail connector protein | - |
| VW923_RS08780 (VW923_08780) | - | 1762957..1764312 (-) | 1356 | WP_329443055.1 | phage major capsid protein | - |
| VW923_RS08785 (VW923_08785) | - | 1764324..1764896 (-) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| VW923_RS08790 (VW923_08790) | - | 1764883..1766094 (-) | 1212 | WP_029677624.1 | phage portal protein | - |
| VW923_RS08795 (VW923_08795) | - | 1766113..1767840 (-) | 1728 | WP_329443050.1 | terminase large subunit | - |
| VW923_RS08800 (VW923_08800) | - | 1767837..1768289 (-) | 453 | WP_002393034.1 | P27 family phage terminase small subunit | - |
| VW923_RS08805 (VW923_08805) | - | 1768404..1768772 (-) | 369 | WP_064687383.1 | HNH endonuclease | - |
| VW923_RS08810 (VW923_08810) | - | 1768772..1769188 (-) | 417 | WP_002393036.1 | hypothetical protein | - |
| VW923_RS08820 (VW923_08820) | - | 1769717..1770184 (-) | 468 | WP_002380819.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW923_RS08825 (VW923_08825) | - | 1770544..1770750 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| VW923_RS08830 (VW923_08830) | - | 1770764..1771348 (-) | 585 | WP_185776395.1 | DUF3850 domain-containing protein | - |
| VW923_RS08835 (VW923_08835) | - | 1771345..1771524 (-) | 180 | WP_185776396.1 | hypothetical protein | - |
| VW923_RS08840 (VW923_08840) | - | 1771521..1771682 (-) | 162 | WP_010774952.1 | hypothetical protein | - |
| VW923_RS08845 (VW923_08845) | - | 1771679..1771987 (-) | 309 | WP_002380822.1 | hypothetical protein | - |
| VW923_RS08850 (VW923_08850) | - | 1771988..1772362 (-) | 375 | WP_010774953.1 | YopX family protein | - |
| VW923_RS08855 (VW923_08855) | - | 1772406..1773170 (-) | 765 | WP_010785682.1 | DNA-methyltransferase | - |
| VW923_RS08860 (VW923_08860) | - | 1773223..1773429 (-) | 207 | WP_002417547.1 | hypothetical protein | - |
| VW923_RS08865 (VW923_08865) | - | 1773439..1773831 (-) | 393 | WP_185776397.1 | hypothetical protein | - |
| VW923_RS08870 (VW923_08870) | - | 1773837..1774445 (-) | 609 | WP_185776398.1 | hypothetical protein | - |
| VW923_RS08875 (VW923_08875) | - | 1774465..1774935 (-) | 471 | WP_002380828.1 | DUF1064 domain-containing protein | - |
| VW923_RS08880 (VW923_08880) | - | 1775084..1775353 (-) | 270 | WP_185776399.1 | hypothetical protein | - |
| VW923_RS08885 (VW923_08885) | - | 1775492..1776331 (-) | 840 | WP_329443017.1 | ATP-binding protein | - |
| VW923_RS08890 (VW923_08890) | - | 1776343..1777122 (-) | 780 | WP_329443014.1 | DnaD domain protein | - |
| VW923_RS08895 (VW923_08895) | - | 1777137..1777952 (-) | 816 | WP_329443011.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VW923_RS08900 (VW923_08900) | - | 1777915..1778886 (-) | 972 | WP_329443008.1 | RecT family recombinase | - |
| VW923_RS08905 (VW923_08905) | - | 1778961..1779266 (-) | 306 | WP_002395805.1 | hypothetical protein | - |
| VW923_RS08910 (VW923_08910) | - | 1779317..1779571 (+) | 255 | WP_002395804.1 | hypothetical protein | - |
| VW923_RS08915 (VW923_08915) | - | 1779546..1779764 (-) | 219 | WP_002370011.1 | hypothetical protein | - |
| VW923_RS08920 (VW923_08920) | - | 1779868..1780092 (-) | 225 | WP_010821117.1 | hypothetical protein | - |
| VW923_RS08925 (VW923_08925) | - | 1780089..1780412 (-) | 324 | WP_329443002.1 | hypothetical protein | - |
| VW923_RS08930 (VW923_08930) | - | 1780503..1780919 (-) | 417 | WP_329442999.1 | hypothetical protein | - |
| VW923_RS08935 (VW923_08935) | - | 1780920..1781099 (-) | 180 | WP_016627612.1 | hypothetical protein | - |
| VW923_RS08940 (VW923_08940) | - | 1781106..1781417 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| VW923_RS08945 (VW923_08945) | - | 1781428..1781604 (-) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| VW923_RS08950 (VW923_08950) | - | 1781915..1782238 (+) | 324 | WP_010826721.1 | helix-turn-helix domain-containing protein | - |
| VW923_RS08955 (VW923_08955) | - | 1782256..1782600 (+) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW923_RS08960 (VW923_08960) | - | 1782634..1783362 (+) | 729 | WP_002364358.1 | ion transporter | - |
| VW923_RS08965 (VW923_08965) | - | 1783459..1784607 (+) | 1149 | WP_002395797.1 | tyrosine-type recombinase/integrase | - |
| VW923_RS08970 (VW923_08970) | comGD | 1784635..1785078 (-) | 444 | WP_002395796.1 | competence type IV pilus minor pilin ComGD | - |
| VW923_RS08975 (VW923_08975) | comGC/cglC | 1785075..1785350 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927183 VW923_RS08975 WP_002356991.1 1785075..1785350(-) (comGC/cglC) [Enterococcus faecalis strain CF4A-3113]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927183 VW923_RS08975 WP_002356991.1 1785075..1785350(-) (comGC/cglC) [Enterococcus faecalis strain CF4A-3113]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |