Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW926_RS04510 | Genome accession | NZ_CP142824 |
| Coordinates | 934650..934925 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CF3A-253 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 929650..939925
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW926_RS04470 (VW926_04470) | - | 929695..930027 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| VW926_RS04475 (VW926_04475) | - | 930205..930678 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| VW926_RS04480 (VW926_04480) | - | 930790..931977 (-) | 1188 | WP_002398460.1 | acetate/propionate family kinase | - |
| VW926_RS04485 (VW926_04485) | - | 932002..933009 (-) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW926_RS04490 (VW926_04490) | comGG | 933138..933491 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW926_RS04495 (VW926_04495) | comGF | 933491..933925 (-) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW926_RS04500 (VW926_04500) | - | 933915..934241 (-) | 327 | WP_002425755.1 | type II secretion system protein | - |
| VW926_RS04505 (VW926_04505) | comGD | 934207..934653 (-) | 447 | WP_002360025.1 | competence type IV pilus minor pilin ComGD | - |
| VW926_RS04510 (VW926_04510) | comGC/cglC | 934650..934925 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW926_RS04515 (VW926_04515) | comGB | 934925..935971 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| VW926_RS04520 (VW926_04520) | comGA | 935928..936896 (-) | 969 | WP_002398077.1 | competence type IV pilus ATPase ComGA | - |
| VW926_RS04525 (VW926_04525) | - | 937138..938466 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| VW926_RS04530 (VW926_04530) | rlmN | 938756..939829 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927135 VW926_RS04510 WP_002356991.1 934650..934925(-) (comGC/cglC) [Enterococcus faecalis strain CF3A-253]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927135 VW926_RS04510 WP_002356991.1 934650..934925(-) (comGC/cglC) [Enterococcus faecalis strain CF3A-253]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |