Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW921_RS01305 | Genome accession | NZ_CP142820 |
| Coordinates | 297475..297750 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CF3A-343 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 297774..343980 | 297475..297750 | flank | 24 |
Gene organization within MGE regions
Location: 297475..343980
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW921_RS01305 (VW921_01305) | comGC/cglC | 297475..297750 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW921_RS01310 (VW921_01310) | comGD | 297747..298190 (+) | 444 | WP_002395796.1 | competence type IV pilus minor pilin ComGD | - |
| VW921_RS01315 (VW921_01315) | - | 298218..299366 (-) | 1149 | WP_002395797.1 | tyrosine-type recombinase/integrase | - |
| VW921_RS01320 (VW921_01320) | - | 299463..300191 (-) | 729 | WP_002364358.1 | ion transporter | - |
| VW921_RS01325 (VW921_01325) | - | 300225..300569 (-) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW921_RS01330 (VW921_01330) | - | 300587..300910 (-) | 324 | WP_010826721.1 | helix-turn-helix domain-containing protein | - |
| VW921_RS01335 (VW921_01335) | - | 301221..301397 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| VW921_RS01340 (VW921_01340) | - | 301408..301719 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| VW921_RS01345 (VW921_01345) | - | 301726..301905 (+) | 180 | WP_016627612.1 | hypothetical protein | - |
| VW921_RS01350 (VW921_01350) | - | 301906..302322 (+) | 417 | WP_329442999.1 | hypothetical protein | - |
| VW921_RS01355 (VW921_01355) | - | 302413..302736 (+) | 324 | WP_329443002.1 | hypothetical protein | - |
| VW921_RS01360 (VW921_01360) | - | 302733..302957 (+) | 225 | WP_010821117.1 | hypothetical protein | - |
| VW921_RS01365 (VW921_01365) | - | 303061..303279 (+) | 219 | WP_002370011.1 | hypothetical protein | - |
| VW921_RS01370 (VW921_01370) | - | 303254..303508 (-) | 255 | WP_002395804.1 | hypothetical protein | - |
| VW921_RS01375 (VW921_01375) | - | 303559..303864 (+) | 306 | WP_002395805.1 | hypothetical protein | - |
| VW921_RS01380 (VW921_01380) | - | 303939..304910 (+) | 972 | WP_329443008.1 | RecT family recombinase | - |
| VW921_RS01385 (VW921_01385) | - | 304873..305688 (+) | 816 | WP_329443011.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VW921_RS01390 (VW921_01390) | - | 305703..306482 (+) | 780 | WP_329443014.1 | DnaD domain protein | - |
| VW921_RS01395 (VW921_01395) | - | 306494..307333 (+) | 840 | WP_329443017.1 | ATP-binding protein | - |
| VW921_RS01400 (VW921_01400) | - | 307472..307741 (+) | 270 | WP_185776399.1 | hypothetical protein | - |
| VW921_RS01405 (VW921_01405) | - | 307890..308360 (+) | 471 | WP_002380828.1 | DUF1064 domain-containing protein | - |
| VW921_RS01410 (VW921_01410) | - | 308380..308988 (+) | 609 | WP_185776398.1 | hypothetical protein | - |
| VW921_RS01415 (VW921_01415) | - | 308994..309386 (+) | 393 | WP_185776397.1 | hypothetical protein | - |
| VW921_RS01420 (VW921_01420) | - | 309396..309602 (+) | 207 | WP_002417547.1 | hypothetical protein | - |
| VW921_RS01425 (VW921_01425) | - | 309655..310419 (+) | 765 | WP_010785682.1 | DNA-methyltransferase | - |
| VW921_RS01430 (VW921_01430) | - | 310463..310837 (+) | 375 | WP_010774953.1 | YopX family protein | - |
| VW921_RS01435 (VW921_01435) | - | 310838..311146 (+) | 309 | WP_002380822.1 | hypothetical protein | - |
| VW921_RS01440 (VW921_01440) | - | 311143..311304 (+) | 162 | WP_010774952.1 | hypothetical protein | - |
| VW921_RS01445 (VW921_01445) | - | 311301..311480 (+) | 180 | WP_185776396.1 | hypothetical protein | - |
| VW921_RS01450 (VW921_01450) | - | 311477..312061 (+) | 585 | WP_185776395.1 | DUF3850 domain-containing protein | - |
| VW921_RS01455 (VW921_01455) | - | 312075..312281 (+) | 207 | WP_116491842.1 | hypothetical protein | - |
| VW921_RS01460 (VW921_01460) | - | 312641..313108 (+) | 468 | WP_002380819.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW921_RS01470 (VW921_01470) | - | 313637..314053 (+) | 417 | WP_002393036.1 | hypothetical protein | - |
| VW921_RS01475 (VW921_01475) | - | 314053..314421 (+) | 369 | WP_064687383.1 | HNH endonuclease | - |
| VW921_RS01480 (VW921_01480) | - | 314536..314988 (+) | 453 | WP_002393034.1 | P27 family phage terminase small subunit | - |
| VW921_RS01485 (VW921_01485) | - | 314985..316712 (+) | 1728 | WP_329443050.1 | terminase large subunit | - |
| VW921_RS01490 (VW921_01490) | - | 316731..317942 (+) | 1212 | WP_029677624.1 | phage portal protein | - |
| VW921_RS01495 (VW921_01495) | - | 317929..318501 (+) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| VW921_RS01500 (VW921_01500) | - | 318513..319868 (+) | 1356 | WP_329443055.1 | phage major capsid protein | - |
| VW921_RS01505 (VW921_01505) | - | 319870..320148 (+) | 279 | WP_002301326.1 | head-tail connector protein | - |
| VW921_RS01510 (VW921_01510) | - | 320129..320455 (+) | 327 | WP_104858196.1 | phage head closure protein | - |
| VW921_RS01515 (VW921_01515) | - | 320445..320783 (+) | 339 | WP_104858197.1 | hypothetical protein | - |
| VW921_RS01520 (VW921_01520) | - | 320773..321135 (+) | 363 | WP_104858198.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VW921_RS01525 (VW921_01525) | - | 321132..321779 (+) | 648 | WP_010784938.1 | major tail protein | - |
| VW921_RS01530 (VW921_01530) | - | 321779..322234 (+) | 456 | WP_002395308.1 | hypothetical protein | - |
| VW921_RS01535 (VW921_01535) | - | 322426..324729 (+) | 2304 | WP_104874255.1 | phage tail tape measure protein | - |
| VW921_RS01540 (VW921_01540) | - | 324726..325439 (+) | 714 | WP_174123966.1 | phage tail protein | - |
| VW921_RS01545 (VW921_01545) | - | 325436..328231 (+) | 2796 | WP_329443077.1 | phage tail tip lysozyme | - |
| VW921_RS01550 (VW921_01550) | - | 328250..329155 (+) | 906 | WP_264547533.1 | phage baseplate upper protein | - |
| VW921_RS01555 (VW921_01555) | - | 329152..329469 (+) | 318 | WP_329442975.1 | hypothetical protein | - |
| VW921_RS01560 (VW921_01560) | - | 329462..329779 (+) | 318 | WP_010823170.1 | hypothetical protein | - |
| VW921_RS01565 (VW921_01565) | - | 329779..330267 (+) | 489 | WP_264547535.1 | hypothetical protein | - |
| VW921_RS01570 (VW921_01570) | - | 330278..330598 (+) | 321 | WP_104874258.1 | hypothetical protein | - |
| VW921_RS01575 (VW921_01575) | - | 330600..330755 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| VW921_RS01580 (VW921_01580) | - | 330783..331004 (+) | 222 | WP_002397443.1 | hypothetical protein | - |
| VW921_RS01585 (VW921_01585) | - | 331001..331204 (+) | 204 | WP_010711247.1 | phage holin | - |
| VW921_RS01590 (VW921_01590) | - | 331209..332294 (+) | 1086 | WP_329443083.1 | SH3 domain-containing protein | - |
| VW921_RS01595 (VW921_01595) | - | 332445..332816 (+) | 372 | WP_181444836.1 | type II secretion system protein | - |
| VW921_RS01600 (VW921_01600) | comGF | 332806..333240 (+) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| VW921_RS01605 (VW921_01605) | comGG | 333240..333593 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| VW921_RS01610 (VW921_01610) | - | 333722..334729 (+) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| VW921_RS01615 (VW921_01615) | - | 334754..335941 (+) | 1188 | WP_002398460.1 | acetate/propionate family kinase | - |
| VW921_RS01620 (VW921_01620) | - | 336053..336526 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| VW921_RS01625 (VW921_01625) | - | 336704..337036 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| VW921_RS01635 (VW921_01635) | - | 337310..338587 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| VW921_RS01640 (VW921_01640) | - | 338716..339393 (+) | 678 | WP_010717036.1 | DNA-3-methyladenine glycosylase | - |
| VW921_RS01645 (VW921_01645) | - | 339350..339835 (+) | 486 | WP_010717035.1 | DUF3013 family protein | - |
| VW921_RS01650 (VW921_01650) | prmA | 339851..340798 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| VW921_RS01655 (VW921_01655) | - | 340800..341552 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| VW921_RS01660 (VW921_01660) | - | 341767..343980 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=927094 VW921_RS01305 WP_002356991.1 297475..297750(+) (comGC/cglC) [Enterococcus faecalis strain CF3A-343]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=927094 VW921_RS01305 WP_002356991.1 297475..297750(+) (comGC/cglC) [Enterococcus faecalis strain CF3A-343]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |