Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW858_RS06345 | Genome accession | NZ_CP142811 |
| Coordinates | 1320170..1320445 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain JF1A-4353 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1320469..1370655 | 1320170..1320445 | flank | 24 |
Gene organization within MGE regions
Location: 1320170..1370655
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW858_RS06345 (VW858_06345) | comGC/cglC | 1320170..1320445 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW858_RS06350 (VW858_06350) | comGD | 1320442..1320876 (+) | 435 | Protein_1245 | competence type IV pilus minor pilin ComGD | - |
| VW858_RS06355 (VW858_06355) | - | 1320913..1322061 (-) | 1149 | WP_002378469.1 | tyrosine-type recombinase/integrase | - |
| VW858_RS06360 (VW858_06360) | - | 1322161..1322889 (-) | 729 | WP_002378468.1 | ion transporter | - |
| VW858_RS06365 (VW858_06365) | - | 1322925..1323269 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW858_RS06370 (VW858_06370) | - | 1323286..1323618 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| VW858_RS06375 (VW858_06375) | - | 1323930..1324106 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| VW858_RS06380 (VW858_06380) | - | 1324117..1324428 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| VW858_RS06385 (VW858_06385) | - | 1324467..1325192 (+) | 726 | WP_002378466.1 | Rha family transcriptional regulator | - |
| VW858_RS06390 (VW858_06390) | - | 1325218..1325406 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| VW858_RS06395 (VW858_06395) | - | 1325461..1325670 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| VW858_RS06400 (VW858_06400) | - | 1325707..1325901 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| VW858_RS06405 (VW858_06405) | - | 1326328..1326882 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| VW858_RS06410 (VW858_06410) | - | 1327102..1327419 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| VW858_RS06415 (VW858_06415) | - | 1327412..1328146 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| VW858_RS06420 (VW858_06420) | - | 1328151..1328792 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| VW858_RS06425 (VW858_06425) | - | 1328797..1328997 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| VW858_RS06430 (VW858_06430) | - | 1328997..1329854 (+) | 858 | WP_329444024.1 | helix-turn-helix domain-containing protein | - |
| VW858_RS06435 (VW858_06435) | - | 1329851..1330258 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VW858_RS06440 (VW858_06440) | - | 1331166..1331582 (+) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW858_RS06450 (VW858_06450) | - | 1333680..1333910 (+) | 231 | Protein_1264 | hypothetical protein | - |
| VW858_RS06455 (VW858_06455) | - | 1334065..1335321 (-) | 1257 | WP_174082522.1 | IS110 family transposase | - |
| VW858_RS06460 (VW858_06460) | - | 1335727..1336161 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| VW858_RS06465 (VW858_06465) | - | 1336142..1337425 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| VW858_RS06470 (VW858_06470) | - | 1337425..1338909 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| VW858_RS06475 (VW858_06475) | - | 1338902..1339828 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| VW858_RS06480 (VW858_06480) | - | 1339951..1340586 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| VW858_RS06485 (VW858_06485) | - | 1340600..1341496 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| VW858_RS06490 (VW858_06490) | - | 1341567..1341899 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| VW858_RS06495 (VW858_06495) | - | 1341896..1342171 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| VW858_RS06500 (VW858_06500) | - | 1342168..1342506 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VW858_RS06505 (VW858_06505) | - | 1342503..1342895 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| VW858_RS06510 (VW858_06510) | - | 1342914..1343519 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| VW858_RS06515 (VW858_06515) | - | 1343522..1343704 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| VW858_RS06520 (VW858_06520) | - | 1343753..1344325 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| VW858_RS06525 (VW858_06525) | - | 1344379..1344777 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| VW858_RS06530 (VW858_06530) | - | 1344846..1345151 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| VW858_RS06535 (VW858_06535) | - | 1345138..1349592 (+) | 4455 | WP_329443539.1 | phage tail tape measure protein | - |
| VW858_RS06540 (VW858_06540) | - | 1349589..1350311 (+) | 723 | WP_002363380.1 | hypothetical protein | - |
| VW858_RS06545 (VW858_06545) | - | 1350311..1351756 (+) | 1446 | WP_002366375.1 | phage tail spike protein | - |
| VW858_RS06550 (VW858_06550) | - | 1351762..1352502 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| VW858_RS06555 (VW858_06555) | - | 1352519..1352971 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| VW858_RS06560 (VW858_06560) | - | 1352990..1353385 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| VW858_RS06565 (VW858_06565) | - | 1353387..1353509 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| VW858_RS06570 (VW858_06570) | - | 1353520..1353900 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| VW858_RS06575 (VW858_06575) | - | 1353913..1355172 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| VW858_RS06580 (VW858_06580) | - | 1356025..1356225 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| VW858_RS06585 (VW858_06585) | - | 1356297..1356569 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| VW858_RS06595 (VW858_06595) | hemH | 1357285..1358226 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| VW858_RS06600 (VW858_06600) | - | 1359027..1359353 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| VW858_RS06605 (VW858_06605) | comGF | 1359343..1359777 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| VW858_RS06610 (VW858_06610) | comGG | 1359777..1360130 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| VW858_RS06615 (VW858_06615) | - | 1360259..1361266 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| VW858_RS06620 (VW858_06620) | - | 1361291..1362478 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| VW858_RS06625 (VW858_06625) | - | 1362590..1363063 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| VW858_RS06630 (VW858_06630) | - | 1363379..1363711 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| VW858_RS06640 (VW858_06640) | - | 1363985..1365262 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| VW858_RS06645 (VW858_06645) | - | 1365391..1366068 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| VW858_RS06650 (VW858_06650) | - | 1366025..1366510 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| VW858_RS06655 (VW858_06655) | prmA | 1366526..1367473 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| VW858_RS06660 (VW858_06660) | - | 1367475..1368227 (+) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| VW858_RS06665 (VW858_06665) | - | 1368442..1370655 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=926964 VW858_RS06345 WP_002356991.1 1320170..1320445(+) (comGC/cglC) [Enterococcus faecalis strain JF1A-4353]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=926964 VW858_RS06345 WP_002356991.1 1320170..1320445(+) (comGC/cglC) [Enterococcus faecalis strain JF1A-4353]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |