Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW861_RS08930 | Genome accession | NZ_CP142810 |
| Coordinates | 1798783..1799058 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain JF1H-454 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1755276..1798759 | 1798783..1799058 | flank | 24 |
Gene organization within MGE regions
Location: 1755276..1799058
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW861_RS08615 (VW861_08615) | - | 1755276..1756283 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| VW861_RS08620 (VW861_08620) | comGG | 1756412..1756765 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| VW861_RS08625 (VW861_08625) | comGF | 1756765..1757199 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| VW861_RS08630 (VW861_08630) | - | 1757189..1757560 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| VW861_RS08635 (VW861_08635) | - | 1757894..1758019 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| VW861_RS08640 (VW861_08640) | hemH | 1758317..1759258 (-) | 942 | WP_116491831.1 | ferrochelatase | - |
| VW861_RS08650 (VW861_08650) | - | 1759580..1760389 (-) | 810 | WP_159162083.1 | DUF3800 domain-containing protein | - |
| VW861_RS08655 (VW861_08655) | - | 1761026..1762327 (-) | 1302 | WP_114232968.1 | LysM peptidoglycan-binding domain-containing protein | - |
| VW861_RS08660 (VW861_08660) | - | 1762330..1762536 (-) | 207 | WP_114232969.1 | phage holin | - |
| VW861_RS08665 (VW861_08665) | - | 1762533..1762754 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| VW861_RS08670 (VW861_08670) | - | 1762782..1762937 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| VW861_RS08675 (VW861_08675) | - | 1762939..1763259 (-) | 321 | WP_002388445.1 | hypothetical protein | - |
| VW861_RS08680 (VW861_08680) | - | 1763273..1763764 (-) | 492 | WP_010711694.1 | hypothetical protein | - |
| VW861_RS08685 (VW861_08685) | - | 1763764..1764042 (-) | 279 | WP_116491832.1 | hypothetical protein | - |
| VW861_RS08690 (VW861_08690) | - | 1764039..1764635 (-) | 597 | WP_116491833.1 | hypothetical protein | - |
| VW861_RS08695 (VW861_08695) | - | 1764628..1765509 (-) | 882 | WP_116491834.1 | phage baseplate upper protein | - |
| VW861_RS08700 (VW861_08700) | - | 1765528..1768335 (-) | 2808 | WP_164549299.1 | phage tail spike protein | - |
| VW861_RS08705 (VW861_08705) | - | 1768317..1769051 (-) | 735 | WP_104670712.1 | phage tail protein | - |
| VW861_RS08710 (VW861_08710) | - | 1769041..1771938 (-) | 2898 | WP_164549302.1 | tape measure protein | - |
| VW861_RS08715 (VW861_08715) | gpG | 1772186..1772536 (-) | 351 | WP_010820912.1 | phage tail assembly chaperone G | - |
| VW861_RS08720 (VW861_08720) | - | 1772588..1773436 (-) | 849 | WP_002387287.1 | major tail protein | - |
| VW861_RS08725 (VW861_08725) | - | 1773437..1773811 (-) | 375 | WP_116491837.1 | DUF6838 family protein | - |
| VW861_RS08730 (VW861_08730) | - | 1773814..1774212 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| VW861_RS08735 (VW861_08735) | - | 1774205..1774579 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| VW861_RS08740 (VW861_08740) | - | 1774576..1774920 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| VW861_RS08745 (VW861_08745) | - | 1774934..1775116 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| VW861_RS08750 (VW861_08750) | - | 1775145..1776032 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| VW861_RS08755 (VW861_08755) | - | 1776046..1776669 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| VW861_RS08760 (VW861_08760) | - | 1776888..1777208 (-) | 321 | WP_116491838.1 | hypothetical protein | - |
| VW861_RS08765 (VW861_08765) | - | 1777265..1777495 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| VW861_RS08770 (VW861_08770) | - | 1777496..1779397 (-) | 1902 | WP_116491839.1 | head protein | - |
| VW861_RS08775 (VW861_08775) | - | 1779375..1780847 (-) | 1473 | WP_116491840.1 | phage portal protein | - |
| VW861_RS08780 (VW861_08780) | terL | 1780859..1782247 (-) | 1389 | WP_164549303.1 | phage terminase large subunit | - |
| VW861_RS08785 (VW861_08785) | - | 1782240..1782701 (-) | 462 | WP_002399680.1 | helix-turn-helix domain-containing protein | - |
| VW861_RS08790 (VW861_08790) | - | 1782732..1782962 (-) | 231 | WP_114232998.1 | hypothetical protein | - |
| VW861_RS08800 (VW861_08800) | - | 1783803..1784219 (-) | 417 | WP_116491841.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW861_RS08805 (VW861_08805) | - | 1784593..1784799 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| VW861_RS08810 (VW861_08810) | - | 1784813..1785397 (-) | 585 | WP_010711679.1 | DUF3850 domain-containing protein | - |
| VW861_RS08815 (VW861_08815) | - | 1785409..1785657 (-) | 249 | WP_002415426.1 | hypothetical protein | - |
| VW861_RS08820 (VW861_08820) | - | 1785654..1786007 (-) | 354 | WP_002415427.1 | hypothetical protein | - |
| VW861_RS08825 (VW861_08825) | - | 1786157..1786852 (-) | 696 | WP_010711678.1 | N-6 DNA methylase | - |
| VW861_RS08830 (VW861_08830) | - | 1787202..1787630 (-) | 429 | WP_164549300.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VW861_RS08835 (VW861_08835) | - | 1787627..1788580 (-) | 954 | WP_116491844.1 | phage replisome organizer N-terminal domain-containing protein | - |
| VW861_RS08840 (VW861_08840) | - | 1788584..1789264 (-) | 681 | WP_116491845.1 | putative HNHc nuclease | - |
| VW861_RS08845 (VW861_08845) | - | 1789261..1790199 (-) | 939 | WP_116491846.1 | DUF1351 domain-containing protein | - |
| VW861_RS08850 (VW861_08850) | - | 1790184..1790861 (-) | 678 | WP_116491847.1 | ERF family protein | - |
| VW861_RS08855 (VW861_08855) | - | 1790854..1791099 (-) | 246 | WP_116491848.1 | hypothetical protein | - |
| VW861_RS08860 (VW861_08860) | - | 1791279..1791602 (-) | 324 | WP_002368201.1 | hypothetical protein | - |
| VW861_RS08865 (VW861_08865) | - | 1791675..1792418 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| VW861_RS08870 (VW861_08870) | - | 1792431..1792838 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| VW861_RS08875 (VW861_08875) | - | 1792907..1793107 (-) | 201 | WP_116491849.1 | hypothetical protein | - |
| VW861_RS08880 (VW861_08880) | - | 1793118..1793303 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| VW861_RS08885 (VW861_08885) | - | 1793314..1794027 (-) | 714 | WP_116491850.1 | Rha family transcriptional regulator | - |
| VW861_RS08890 (VW861_08890) | - | 1794066..1794383 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| VW861_RS08895 (VW861_08895) | - | 1794389..1794580 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| VW861_RS08900 (VW861_08900) | - | 1794873..1795214 (+) | 342 | WP_002396615.1 | helix-turn-helix domain-containing protein | - |
| VW861_RS08905 (VW861_08905) | - | 1795219..1795866 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW861_RS08910 (VW861_08910) | - | 1795984..1796748 (+) | 765 | WP_229077509.1 | LysM peptidoglycan-binding domain-containing protein | - |
| VW861_RS08915 (VW861_08915) | - | 1796763..1797092 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| VW861_RS08920 (VW861_08920) | - | 1797167..1798315 (+) | 1149 | WP_116491852.1 | tyrosine-type recombinase/integrase | - |
| VW861_RS08925 (VW861_08925) | comGD | 1798343..1798786 (-) | 444 | WP_116491816.1 | competence type IV pilus minor pilin ComGD | - |
| VW861_RS08930 (VW861_08930) | comGC/cglC | 1798783..1799058 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=926930 VW861_RS08930 WP_002356991.1 1798783..1799058(-) (comGC/cglC) [Enterococcus faecalis strain JF1H-454]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=926930 VW861_RS08930 WP_002356991.1 1798783..1799058(-) (comGC/cglC) [Enterococcus faecalis strain JF1H-454]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |