Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | VW859_RS08805 | Genome accession | NZ_CP142809 |
| Coordinates | 1782148..1782423 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain KS2H-124 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1742637..1800530 | 1782148..1782423 | within | 0 |
Gene organization within MGE regions
Location: 1742637..1800530
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW859_RS08530 (VW859_08530) | - | 1742637..1743644 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| VW859_RS08535 (VW859_08535) | comGG | 1743773..1744126 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| VW859_RS08540 (VW859_08540) | comGF | 1744126..1744560 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| VW859_RS08545 (VW859_08545) | - | 1744550..1744876 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| VW859_RS08550 (VW859_08550) | hemH | 1745677..1746618 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| VW859_RS08560 (VW859_08560) | - | 1747334..1747606 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| VW859_RS08565 (VW859_08565) | - | 1747678..1747878 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| VW859_RS08570 (VW859_08570) | - | 1748731..1749990 (-) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| VW859_RS08575 (VW859_08575) | - | 1750003..1750383 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| VW859_RS08580 (VW859_08580) | - | 1750394..1750516 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| VW859_RS08585 (VW859_08585) | - | 1750518..1750913 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| VW859_RS08590 (VW859_08590) | - | 1750932..1751384 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| VW859_RS08595 (VW859_08595) | - | 1751401..1752141 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| VW859_RS08600 (VW859_08600) | - | 1752147..1753592 (-) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| VW859_RS08605 (VW859_08605) | - | 1753592..1754314 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| VW859_RS08610 (VW859_08610) | - | 1754311..1758765 (-) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| VW859_RS08615 (VW859_08615) | - | 1758752..1759057 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| VW859_RS08620 (VW859_08620) | - | 1759126..1759524 (-) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| VW859_RS08625 (VW859_08625) | - | 1759578..1760150 (-) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| VW859_RS08630 (VW859_08630) | - | 1760199..1760381 (-) | 183 | WP_002378453.1 | hypothetical protein | - |
| VW859_RS08635 (VW859_08635) | - | 1760384..1760989 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| VW859_RS08640 (VW859_08640) | - | 1761008..1761400 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| VW859_RS08645 (VW859_08645) | - | 1761397..1761735 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VW859_RS08650 (VW859_08650) | - | 1761732..1762007 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| VW859_RS08655 (VW859_08655) | - | 1762004..1762336 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| VW859_RS08660 (VW859_08660) | - | 1762407..1763303 (-) | 897 | WP_002378455.1 | hypothetical protein | - |
| VW859_RS08665 (VW859_08665) | - | 1763317..1763952 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| VW859_RS08670 (VW859_08670) | - | 1764075..1765001 (-) | 927 | WP_002378457.1 | minor capsid protein | - |
| VW859_RS08675 (VW859_08675) | - | 1764994..1766478 (-) | 1485 | WP_002378458.1 | phage portal protein | - |
| VW859_RS08680 (VW859_08680) | - | 1766478..1767761 (-) | 1284 | WP_329430800.1 | PBSX family phage terminase large subunit | - |
| VW859_RS08685 (VW859_08685) | - | 1767742..1768176 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| VW859_RS08690 (VW859_08690) | - | 1768208..1768438 (-) | 231 | Protein_1679 | hypothetical protein | - |
| VW859_RS08695 (VW859_08695) | - | 1768909..1769271 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| VW859_RS08700 (VW859_08700) | - | 1769388..1770296 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| VW859_RS08710 (VW859_08710) | - | 1771011..1771427 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VW859_RS08715 (VW859_08715) | - | 1772335..1772742 (-) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VW859_RS08720 (VW859_08720) | - | 1772739..1773596 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| VW859_RS08725 (VW859_08725) | - | 1773596..1773796 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| VW859_RS08730 (VW859_08730) | - | 1773801..1774442 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| VW859_RS08735 (VW859_08735) | - | 1774447..1775181 (-) | 735 | WP_002378463.1 | ERF family protein | - |
| VW859_RS08740 (VW859_08740) | - | 1775174..1775491 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| VW859_RS08745 (VW859_08745) | - | 1775711..1776265 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| VW859_RS08750 (VW859_08750) | - | 1776692..1776886 (-) | 195 | WP_002378464.1 | hypothetical protein | - |
| VW859_RS08755 (VW859_08755) | - | 1776923..1777132 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| VW859_RS08760 (VW859_08760) | - | 1777187..1777375 (+) | 189 | WP_329430801.1 | YegP family protein | - |
| VW859_RS08765 (VW859_08765) | - | 1777401..1778126 (-) | 726 | WP_002378466.1 | Rha family transcriptional regulator | - |
| VW859_RS08770 (VW859_08770) | - | 1778165..1778476 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| VW859_RS08775 (VW859_08775) | - | 1778487..1778663 (-) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| VW859_RS08780 (VW859_08780) | - | 1778975..1779307 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| VW859_RS08785 (VW859_08785) | - | 1779324..1779668 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VW859_RS08790 (VW859_08790) | - | 1779704..1780432 (+) | 729 | WP_002378468.1 | ion transporter | - |
| VW859_RS08795 (VW859_08795) | - | 1780532..1781680 (+) | 1149 | WP_002378469.1 | tyrosine-type recombinase/integrase | - |
| VW859_RS08800 (VW859_08800) | comGD | 1781717..1782151 (-) | 435 | Protein_1700 | competence type IV pilus minor pilin ComGD | - |
| VW859_RS08805 (VW859_08805) | comGC/cglC | 1782148..1782423 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VW859_RS08810 (VW859_08810) | comGB | 1782423..1783469 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| VW859_RS08815 (VW859_08815) | comGA | 1783426..1784394 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| VW859_RS08820 (VW859_08820) | - | 1784635..1785963 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| VW859_RS08825 (VW859_08825) | rlmN | 1786253..1787326 (-) | 1074 | WP_002378471.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| VW859_RS08830 (VW859_08830) | - | 1787452..1789281 (-) | 1830 | WP_329430803.1 | ABC transporter permease | - |
| VW859_RS08835 (VW859_08835) | - | 1789271..1790020 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| VW859_RS08840 (VW859_08840) | - | 1790138..1790839 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| VW859_RS08845 (VW859_08845) | - | 1790970..1793393 (-) | 2424 | WP_002378474.1 | DNA translocase FtsK | - |
| VW859_RS08850 (VW859_08850) | - | 1793707..1794918 (-) | 1212 | WP_002378475.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| VW859_RS08855 (VW859_08855) | - | 1794947..1795852 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| VW859_RS08860 (VW859_08860) | - | 1795974..1796954 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| VW859_RS08865 (VW859_08865) | cydC | 1797034..1798800 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| VW859_RS08870 (VW859_08870) | cydD | 1798797..1800530 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=926892 VW859_RS08805 WP_002356991.1 1782148..1782423(-) (comGC/cglC) [Enterococcus faecalis strain KS2H-124]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=926892 VW859_RS08805 WP_002356991.1 1782148..1782423(-) (comGC/cglC) [Enterococcus faecalis strain KS2H-124]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |