Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VVB72_RS10150 | Genome accession | NZ_CP142589 |
| Coordinates | 2041213..2041638 (-) | Length | 141 a.a. |
| NCBI ID | WP_039116136.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain C20 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2006525..2053841 | 2041213..2041638 | within | 0 |
Gene organization within MGE regions
Location: 2006525..2053841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VVB72_RS09920 (VVB72_09920) | pknB | 2006525..2008408 (-) | 1884 | WP_327063072.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| VVB72_RS09925 (VVB72_09925) | - | 2008408..2009184 (-) | 777 | WP_039116084.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| VVB72_RS09930 (VVB72_09930) | rsmB | 2009265..2010539 (-) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| VVB72_RS09940 (VVB72_09940) | - | 2011742..2012596 (-) | 855 | WP_039116086.1 | GH25 family lysozyme | - |
| VVB72_RS09945 (VVB72_09945) | - | 2012598..2013050 (-) | 453 | WP_039116087.1 | phage holin | - |
| VVB72_RS09950 (VVB72_09950) | - | 2013066..2013413 (-) | 348 | WP_011835796.1 | hypothetical protein | - |
| VVB72_RS09955 (VVB72_09955) | - | 2013426..2013662 (-) | 237 | WP_039116726.1 | hypothetical protein | - |
| VVB72_RS09960 (VVB72_09960) | - | 2013673..2017122 (-) | 3450 | WP_052230931.1 | hypothetical protein | - |
| VVB72_RS09965 (VVB72_09965) | - | 2017122..2018648 (-) | 1527 | WP_155276109.1 | distal tail protein Dit | - |
| VVB72_RS09970 (VVB72_09970) | - | 2018645..2022697 (-) | 4053 | WP_052230932.1 | phage tail tape measure protein | - |
| VVB72_RS09975 (VVB72_09975) | - | 2022808..2023470 (-) | 663 | WP_230593116.1 | DUF4352 domain-containing protein | - |
| VVB72_RS09980 (VVB72_09980) | - | 2023572..2023784 (-) | 213 | WP_039116089.1 | hypothetical protein | - |
| VVB72_RS09985 (VVB72_09985) | gpG | 2023781..2024098 (-) | 318 | WP_270095133.1 | phage tail assembly chaperone G | - |
| VVB72_RS09990 (VVB72_09990) | - | 2024102..2024701 (-) | 600 | WP_039116091.1 | major tail protein | - |
| VVB72_RS09995 (VVB72_09995) | - | 2024720..2025109 (-) | 390 | WP_023189090.1 | hypothetical protein | - |
| VVB72_RS10000 (VVB72_10000) | - | 2025106..2025510 (-) | 405 | WP_039116093.1 | HK97 gp10 family phage protein | - |
| VVB72_RS10005 (VVB72_10005) | - | 2025503..2025889 (-) | 387 | WP_039116095.1 | hypothetical protein | - |
| VVB72_RS10010 (VVB72_10010) | - | 2025886..2026188 (-) | 303 | WP_039116097.1 | hypothetical protein | - |
| VVB72_RS10015 (VVB72_10015) | - | 2026201..2026356 (-) | 156 | WP_167593704.1 | hypothetical protein | - |
| VVB72_RS10020 (VVB72_10020) | - | 2026367..2027512 (-) | 1146 | WP_039116099.1 | phage major capsid protein | - |
| VVB72_RS10025 (VVB72_10025) | - | 2027512..2028330 (-) | 819 | WP_052230934.1 | head maturation protease, ClpP-related | - |
| VVB72_RS10030 (VVB72_10030) | - | 2028317..2029510 (-) | 1194 | WP_039116101.1 | phage portal protein | - |
| VVB72_RS10035 (VVB72_10035) | - | 2029793..2030443 (-) | 651 | WP_039116103.1 | hypothetical protein | - |
| VVB72_RS10040 (VVB72_10040) | - | 2030520..2032259 (-) | 1740 | WP_039116105.1 | terminase large subunit domain-containing protein | - |
| VVB72_RS10045 (VVB72_10045) | - | 2032256..2032900 (-) | 645 | WP_270095134.1 | helix-turn-helix domain-containing protein | - |
| VVB72_RS10050 (VVB72_10050) | - | 2032991..2033290 (-) | 300 | WP_039116107.1 | HNH endonuclease | - |
| VVB72_RS10055 (VVB72_10055) | - | 2033339..2033638 (-) | 300 | WP_039116109.1 | hypothetical protein | - |
| VVB72_RS10060 (VVB72_10060) | - | 2033716..2033988 (-) | 273 | WP_039116111.1 | hypothetical protein | - |
| VVB72_RS10065 (VVB72_10065) | - | 2034513..2034668 (+) | 156 | WP_014572174.1 | hypothetical protein | - |
| VVB72_RS10070 (VVB72_10070) | - | 2034707..2034886 (-) | 180 | WP_039116113.1 | DUF1660 domain-containing protein | - |
| VVB72_RS10075 (VVB72_10075) | - | 2034883..2035317 (-) | 435 | WP_039116115.1 | DNA N-6-adenine-methyltransferase | - |
| VVB72_RS10080 (VVB72_10080) | - | 2035310..2035705 (-) | 396 | WP_039116116.1 | hypothetical protein | - |
| VVB72_RS10085 (VVB72_10085) | - | 2035813..2036076 (-) | 264 | WP_080756669.1 | hypothetical protein | - |
| VVB72_RS10090 (VVB72_10090) | - | 2036331..2036660 (-) | 330 | WP_039116117.1 | hypothetical protein | - |
| VVB72_RS10095 (VVB72_10095) | - | 2036657..2037283 (-) | 627 | WP_039116118.1 | DUF1642 domain-containing protein | - |
| VVB72_RS10100 (VVB72_10100) | - | 2037276..2037557 (-) | 282 | WP_039116119.1 | hypothetical protein | - |
| VVB72_RS10105 (VVB72_10105) | - | 2037550..2037843 (-) | 294 | WP_155276110.1 | hypothetical protein | - |
| VVB72_RS10110 (VVB72_10110) | - | 2037861..2038049 (-) | 189 | WP_039116120.1 | hypothetical protein | - |
| VVB72_RS10115 (VVB72_10115) | - | 2038060..2038422 (-) | 363 | WP_039116122.1 | DUF658 family protein | - |
| VVB72_RS10120 (VVB72_10120) | - | 2038397..2038561 (-) | 165 | WP_010905354.1 | hypothetical protein | - |
| VVB72_RS10125 (VVB72_10125) | - | 2038669..2038908 (-) | 240 | WP_039116124.1 | DUF1031 domain-containing protein | - |
| VVB72_RS10130 (VVB72_10130) | - | 2038905..2039279 (-) | 375 | WP_039116126.1 | DUF1064 domain-containing protein | - |
| VVB72_RS10135 (VVB72_10135) | - | 2039260..2039433 (-) | 174 | WP_039116128.1 | hypothetical protein | - |
| VVB72_RS10140 (VVB72_10140) | - | 2039442..2040332 (-) | 891 | WP_039116130.1 | ATP-binding protein | - |
| VVB72_RS10145 (VVB72_10145) | - | 2040342..2041088 (-) | 747 | WP_039116133.1 | conserved phage C-terminal domain-containing protein | - |
| VVB72_RS10150 (VVB72_10150) | ssb | 2041213..2041638 (-) | 426 | WP_039116136.1 | single-stranded DNA-binding protein | Machinery gene |
| VVB72_RS10155 (VVB72_10155) | - | 2041631..2042389 (-) | 759 | WP_039116138.1 | Rad52/Rad22 family DNA repair protein | - |
| VVB72_RS10160 (VVB72_10160) | - | 2042398..2042793 (-) | 396 | WP_039116139.1 | hypothetical protein | - |
| VVB72_RS10165 (VVB72_10165) | - | 2042892..2043038 (-) | 147 | WP_021469336.1 | hypothetical protein | - |
| VVB72_RS10170 (VVB72_10170) | - | 2043143..2043532 (+) | 390 | WP_039116140.1 | hypothetical protein | - |
| VVB72_RS10175 (VVB72_10175) | - | 2043525..2043689 (-) | 165 | WP_155276111.1 | hypothetical protein | - |
| VVB72_RS10180 (VVB72_10180) | - | 2043782..2044051 (-) | 270 | WP_021212293.1 | hypothetical protein | - |
| VVB72_RS10185 (VVB72_10185) | - | 2044064..2044816 (-) | 753 | WP_039116143.1 | phage antirepressor KilAC domain-containing protein | - |
| VVB72_RS10190 (VVB72_10190) | - | 2044828..2045076 (-) | 249 | WP_031559261.1 | helix-turn-helix transcriptional regulator | - |
| VVB72_RS12140 | - | 2045209..2045346 (+) | 138 | WP_080756632.1 | zinc ribbon-containing protein | - |
| VVB72_RS10195 (VVB72_10195) | - | 2045376..2045498 (-) | 123 | WP_258553365.1 | hypothetical protein | - |
| VVB72_RS10200 (VVB72_10200) | - | 2045655..2046500 (+) | 846 | WP_039116146.1 | Abi-alpha family protein | - |
| VVB72_RS10205 (VVB72_10205) | - | 2046912..2047478 (+) | 567 | WP_039116148.1 | helix-turn-helix domain-containing protein | - |
| VVB72_RS10210 (VVB72_10210) | - | 2047484..2047918 (+) | 435 | WP_039116150.1 | zinc peptidase | - |
| VVB72_RS10215 (VVB72_10215) | - | 2047932..2048267 (+) | 336 | WP_031559267.1 | hypothetical protein | - |
| VVB72_RS10220 (VVB72_10220) | - | 2048334..2049515 (+) | 1182 | WP_031559268.1 | tyrosine-type recombinase/integrase | - |
| VVB72_RS10225 (VVB72_10225) | - | 2049816..2050322 (-) | 507 | WP_012898444.1 | Asp23/Gls24 family envelope stress response protein | - |
| VVB72_RS10230 (VVB72_10230) | - | 2050343..2050531 (-) | 189 | WP_012898445.1 | DUF2273 domain-containing protein | - |
| VVB72_RS10235 (VVB72_10235) | amaP | 2050542..2051102 (-) | 561 | WP_010906186.1 | alkaline shock response membrane anchor protein AmaP | - |
| VVB72_RS10240 (VVB72_10240) | - | 2051130..2051372 (-) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| VVB72_RS10245 (VVB72_10245) | fmt | 2051547..2052506 (-) | 960 | WP_023189127.1 | methionyl-tRNA formyltransferase | - |
| VVB72_RS10250 (VVB72_10250) | - | 2052503..2052967 (-) | 465 | WP_003131474.1 | VOC family protein | - |
| VVB72_RS10255 (VVB72_10255) | - | 2052933..2053454 (-) | 522 | WP_023189128.1 | NUDIX hydrolase | - |
| VVB72_RS10260 (VVB72_10260) | - | 2053467..2053841 (-) | 375 | WP_025017158.1 | nuclear transport factor 2 family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15815.50 Da Isoelectric Point: 5.1972
>NTDB_id=926085 VVB72_RS10150 WP_039116136.1 2041213..2041638(-) (ssb) [Lactococcus lactis subsp. lactis strain C20]
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNSNGERETDFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPIEISDDDLPF
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNSNGERETDFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPIEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=926085 VVB72_RS10150 WP_039116136.1 2041213..2041638(-) (ssb) [Lactococcus lactis subsp. lactis strain C20]
ATGATTAATAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAGAATTCCAATGGAGAAAGAGAAACTGACTTTATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATAGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAATAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAGAATTCCAATGGAGAAAGAGAAACTGACTTTATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATAGAAA
TTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.645 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.163 |
100 |
0.624 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.769 |
73.759 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
38.298 |
100 |
0.383 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.515 |
73.05 |
0.362 |