Detailed information    

insolico Bioinformatically predicted

Overview

Name   comYC   Type   Machinery gene
Locus tag   VNN44_RS03190 Genome accession   NZ_CP141689
Coordinates   642311..642613 (-) Length   100 a.a.
NCBI ID   WP_346349212.1    Uniprot ID   -
Organism   Lactococcus petauri strain R22-16 FS-A5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 637311..647613
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VNN44_RS03160 (VNN44_03160) - 639200..640084 (+) 885 WP_019336000.1 RluA family pseudouridine synthase -
  VNN44_RS03165 (VNN44_03165) - 640155..641000 (-) 846 WP_019336001.1 zinc ABC transporter substrate-binding protein -
  VNN44_RS03170 (VNN44_03170) comYF 641232..641498 (-) 267 WP_255566449.1 competence type IV pilus minor pilin ComGF Machinery gene
  VNN44_RS03175 (VNN44_03175) comGE 641653..641817 (-) 165 WP_019336003.1 competence system putative prepilin ComGE -
  VNN44_RS03180 (VNN44_03180) - 641790..641888 (-) 99 WP_255566393.1 hypothetical protein -
  VNN44_RS03185 (VNN44_03185) comGD 641920..642336 (-) 417 WP_019336004.1 competence type IV pilus minor pilin ComGD Machinery gene
  VNN44_RS03190 (VNN44_03190) comYC 642311..642613 (-) 303 WP_346349212.1 competence type IV pilus major pilin ComGC Machinery gene
  VNN44_RS03195 (VNN44_03195) comGB 642632..643651 (-) 1020 WP_255566448.1 competence type IV pilus assembly protein ComGB Machinery gene
  VNN44_RS03200 (VNN44_03200) comGA 643590..644534 (-) 945 WP_195916935.1 competence type IV pilus ATPase ComGA Machinery gene
  VNN44_RS03205 (VNN44_03205) rpsU 644720..644896 (-) 177 WP_003134539.1 30S ribosomal protein S21 -
  VNN44_RS03210 (VNN44_03210) guaB 645022..646503 (-) 1482 WP_003133714.1 IMP dehydrogenase -

Sequence

Protein


Download         Length: 100 a.a.        Molecular weight: 11245.18 Da        Isoelectric Point: 10.0997

>NTDB_id=918178 VNN44_RS03190 WP_346349212.1 642311..642613(-) (comYC) [Lactococcus petauri strain R22-16 FS-A5]
MKKRIKAFTLIEMLVVLLIISVLLLLFVPNLAKEKKNIQNTGQTAVVKVVEGQAELYQLDKQDSPNLGKLVSDGLITQKQ
ADSYNDYYTKNPNAKRNVPN

Nucleotide


Download         Length: 303 bp        

>NTDB_id=918178 VNN44_RS03190 WP_346349212.1 642311..642613(-) (comYC) [Lactococcus petauri strain R22-16 FS-A5]
ATGAAAAAGAGAATCAAAGCTTTTACTTTGATTGAAATGCTTGTCGTCTTACTTATTATCAGTGTGTTACTTTTATTGTT
TGTCCCAAATTTGGCTAAAGAAAAGAAGAATATCCAAAATACGGGTCAAACAGCGGTTGTTAAGGTTGTCGAAGGTCAAG
CCGAACTTTATCAACTTGATAAACAGGATAGTCCTAACTTAGGGAAGCTTGTCTCCGACGGTTTAATTACGCAAAAACAA
GCCGATAGCTACAATGATTATTATACCAAGAACCCTAATGCAAAACGTAATGTACCGAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-26)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.