NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	SK061_RS22265	Genome accession	NZ_CP139190
Coordinates	4277521..4277862 (-)	Length	113 a.a.
NCBI ID	WP_006639351.1	Uniprot ID	A0A7Y8S016
Organism	Bacillus sonorensis strain PMC204
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 4272521..4282862

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SK061_RS22235 (SK061_22235)	srlD	4273136..4273921 (-)	786	WP_006639345.1	sorbitol-6-phosphate dehydrogenase	-
SK061_RS22240 (SK061_22240)	-	4273939..4274304 (-)	366	WP_006639346.1	PTS glucitol/sorbitol transporter subunit IIA	-
SK061_RS22245 (SK061_22245)	-	4274328..4275335 (-)	1008	WP_006639347.1	PTS glucitol/sorbitol transporter subunit IIB	-
SK061_RS22250 (SK061_22250)	-	4275352..4275900 (-)	549	WP_006639348.1	PTS glucitol/sorbitol transporter subunit IIC	-
SK061_RS22255 (SK061_22255)	-	4275897..4276340 (-)	444	WP_006639349.1	transcriptional regulator GutM	-
SK061_RS22260 (SK061_22260)	-	4276337..4277299 (-)	963	WP_029419610.1	sugar-binding transcriptional regulator	-
SK061_RS22265 (SK061_22265)	ssbB	4277521..4277862 (-)	342	WP_006639351.1	single-stranded DNA-binding protein	Machinery gene
SK061_RS22270 (SK061_22270)	-	4278134..4278547 (+)	414	WP_006639352.1	YwpF-like family protein	-
SK061_RS22275 (SK061_22275)	mscL	4278589..4278978 (-)	390	WP_006639353.1	large conductance mechanosensitive channel protein MscL	-
SK061_RS22280 (SK061_22280)	fabZ	4279052..4279486 (-)	435	WP_006639354.1	3-hydroxyacyl-ACP dehydratase FabZ	-
SK061_RS22285 (SK061_22285)	-	4279720..4280544 (-)	825	WP_006639355.1	flagellar hook-basal body protein	-
SK061_RS22290 (SK061_22290)	-	4280606..4281445 (-)	840	WP_006639356.1	flagellar hook-basal body protein	-
SK061_RS22295 (SK061_22295)	mbl	4281649..4282650 (-)	1002	WP_006639357.1	cell shape-determining protein Mbl	-

Sequence

Protein

Download Length: 113 a.a. Molecular weight: 12603.40 Da Isoelectric Point: 9.9328

                                >NTDB_id=907761 SK061_RS22265 WP_006639351.1 4277521..4277862(-) (ssbB) [Bacillus sonorensis strain PMC204]

MFNQIMLVGRLTKDPELRYTSDGVPVANITLAVSRHFKNAAGKIETDFVNCTLWRKTAENTADYCSKGSIVGLNGRIQTR

HYVNSEGKRIFLTEVVARSAHFLGGKTRETAEI

Nucleotide

Download Length: 342 bp

                                >NTDB_id=907761 SK061_RS22265 WP_006639351.1 4277521..4277862(-) (ssbB) [Bacillus sonorensis strain PMC204]

ATGTTTAATCAGATCATGCTGGTCGGGCGTTTAACGAAGGACCCGGAGCTGCGGTATACATCTGACGGTGTCCCTGTTGC

AAATATTACTTTGGCTGTCAGCAGGCATTTCAAAAATGCCGCAGGCAAAATTGAAACGGACTTTGTCAATTGCACATTGT

GGCGAAAAACGGCTGAAAATACGGCTGACTATTGCAGCAAAGGCTCTATTGTCGGCTTGAACGGCAGAATTCAAACACGC

CATTATGTGAATTCAGAAGGGAAACGCATCTTTCTAACAGAAGTCGTCGCCCGCTCCGCTCATTTTTTGGGCGGAAAAAC

CCGCGAAACCGCAGAGATCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A7Y8S016

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	67.568	98.23	0.664
ssbA	Bacillus subtilis subsp. subtilis str. 168	56.075	94.69	0.531
ssb	Latilactobacillus sakei subsp. sakei 23K	51.402	94.69	0.487
ssbB	Streptococcus sobrinus strain NIDR 6715-7	42.593	95.575	0.407
ssbA	Streptococcus mutans UA159	40.741	95.575	0.389
ssbB	Lactococcus lactis subsp. cremoris KW2	37.719	100	0.381
ssb	Vibrio cholerae strain A1552	36.842	100	0.372
ssbB/cilA	Streptococcus mitis NCTC 12261	37.963	95.575	0.363
ssbB/cilA	Streptococcus pneumoniae TIGR4	37.963	95.575	0.363
ssb	Neisseria meningitidis MC58	37.963	95.575	0.363
ssb	Neisseria gonorrhoeae MS11	37.963	95.575	0.363

Detailed information NTG0907761