Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | SHT66_RS09200 | Genome accession | NZ_CP138637 |
| Coordinates | 1844718..1844993 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain ES-3-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1801211..1844694 | 1844718..1844993 | flank | 24 |
Gene organization within MGE regions
Location: 1801211..1844993
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SHT66_RS08885 (SHT66_08885) | - | 1801211..1802218 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| SHT66_RS08890 (SHT66_08890) | comGG | 1802347..1802700 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| SHT66_RS08895 (SHT66_08895) | comGF | 1802700..1803134 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| SHT66_RS08900 (SHT66_08900) | - | 1803124..1803495 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| SHT66_RS08905 (SHT66_08905) | - | 1803829..1803954 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| SHT66_RS08910 (SHT66_08910) | hemH | 1804252..1805193 (-) | 942 | WP_116491831.1 | ferrochelatase | - |
| SHT66_RS08920 (SHT66_08920) | - | 1805515..1806324 (-) | 810 | WP_159162083.1 | DUF3800 domain-containing protein | - |
| SHT66_RS08925 (SHT66_08925) | - | 1806961..1808262 (-) | 1302 | WP_114232968.1 | LysM peptidoglycan-binding domain-containing protein | - |
| SHT66_RS08930 (SHT66_08930) | - | 1808265..1808471 (-) | 207 | WP_114232969.1 | phage holin | - |
| SHT66_RS08935 (SHT66_08935) | - | 1808468..1808689 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| SHT66_RS08940 (SHT66_08940) | - | 1808717..1808872 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| SHT66_RS08945 (SHT66_08945) | - | 1808874..1809194 (-) | 321 | WP_002388445.1 | hypothetical protein | - |
| SHT66_RS08950 (SHT66_08950) | - | 1809208..1809699 (-) | 492 | WP_010711694.1 | hypothetical protein | - |
| SHT66_RS08955 (SHT66_08955) | - | 1809699..1809977 (-) | 279 | WP_116491832.1 | hypothetical protein | - |
| SHT66_RS08960 (SHT66_08960) | - | 1809974..1810570 (-) | 597 | WP_116491833.1 | hypothetical protein | - |
| SHT66_RS08965 (SHT66_08965) | - | 1810563..1811444 (-) | 882 | WP_116491834.1 | phage baseplate upper protein | - |
| SHT66_RS08970 (SHT66_08970) | - | 1811463..1814270 (-) | 2808 | WP_164549299.1 | phage tail spike protein | - |
| SHT66_RS08975 (SHT66_08975) | - | 1814252..1814986 (-) | 735 | WP_104670712.1 | phage tail protein | - |
| SHT66_RS08980 (SHT66_08980) | - | 1814976..1817873 (-) | 2898 | WP_164549302.1 | tape measure protein | - |
| SHT66_RS08985 (SHT66_08985) | gpG | 1818121..1818471 (-) | 351 | WP_010820912.1 | phage tail assembly chaperone G | - |
| SHT66_RS08990 (SHT66_08990) | - | 1818523..1819371 (-) | 849 | WP_002387287.1 | major tail protein | - |
| SHT66_RS08995 (SHT66_08995) | - | 1819372..1819746 (-) | 375 | WP_116491837.1 | DUF6838 family protein | - |
| SHT66_RS09000 (SHT66_09000) | - | 1819749..1820147 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| SHT66_RS09005 (SHT66_09005) | - | 1820140..1820514 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| SHT66_RS09010 (SHT66_09010) | - | 1820511..1820855 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| SHT66_RS09015 (SHT66_09015) | - | 1820869..1821051 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| SHT66_RS09020 (SHT66_09020) | - | 1821080..1821967 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| SHT66_RS09025 (SHT66_09025) | - | 1821981..1822604 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| SHT66_RS09030 (SHT66_09030) | - | 1822823..1823143 (-) | 321 | WP_116491838.1 | hypothetical protein | - |
| SHT66_RS09035 (SHT66_09035) | - | 1823200..1823430 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| SHT66_RS09040 (SHT66_09040) | - | 1823431..1825332 (-) | 1902 | WP_116491839.1 | head protein | - |
| SHT66_RS09045 (SHT66_09045) | - | 1825310..1826782 (-) | 1473 | WP_116491840.1 | phage portal protein | - |
| SHT66_RS09050 (SHT66_09050) | terL | 1826794..1828182 (-) | 1389 | WP_164549303.1 | phage terminase large subunit | - |
| SHT66_RS09055 (SHT66_09055) | - | 1828175..1828636 (-) | 462 | WP_002399680.1 | helix-turn-helix domain-containing protein | - |
| SHT66_RS09060 (SHT66_09060) | - | 1828667..1828897 (-) | 231 | WP_114232998.1 | hypothetical protein | - |
| SHT66_RS09070 (SHT66_09070) | - | 1829738..1830154 (-) | 417 | WP_116491841.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SHT66_RS09075 (SHT66_09075) | - | 1830528..1830734 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| SHT66_RS09080 (SHT66_09080) | - | 1830748..1831332 (-) | 585 | WP_010711679.1 | DUF3850 domain-containing protein | - |
| SHT66_RS09085 (SHT66_09085) | - | 1831344..1831592 (-) | 249 | WP_002415426.1 | hypothetical protein | - |
| SHT66_RS09090 (SHT66_09090) | - | 1831589..1831942 (-) | 354 | WP_002415427.1 | hypothetical protein | - |
| SHT66_RS09095 (SHT66_09095) | - | 1832092..1832826 (-) | 735 | WP_249455863.1 | N-6 DNA methylase | - |
| SHT66_RS09100 (SHT66_09100) | - | 1833137..1833565 (-) | 429 | WP_164549300.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SHT66_RS09105 (SHT66_09105) | - | 1833562..1834515 (-) | 954 | WP_116491844.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SHT66_RS09110 (SHT66_09110) | - | 1834519..1835199 (-) | 681 | WP_116491845.1 | putative HNHc nuclease | - |
| SHT66_RS09115 (SHT66_09115) | - | 1835196..1836134 (-) | 939 | WP_116491846.1 | DUF1351 domain-containing protein | - |
| SHT66_RS09120 (SHT66_09120) | - | 1836119..1836796 (-) | 678 | WP_116491847.1 | ERF family protein | - |
| SHT66_RS09125 (SHT66_09125) | - | 1836789..1837034 (-) | 246 | WP_116491848.1 | hypothetical protein | - |
| SHT66_RS09130 (SHT66_09130) | - | 1837214..1837537 (-) | 324 | WP_002368201.1 | hypothetical protein | - |
| SHT66_RS09135 (SHT66_09135) | - | 1837610..1838353 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| SHT66_RS09140 (SHT66_09140) | - | 1838366..1838773 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| SHT66_RS09145 (SHT66_09145) | - | 1838842..1839042 (-) | 201 | WP_116491849.1 | hypothetical protein | - |
| SHT66_RS09150 (SHT66_09150) | - | 1839053..1839238 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| SHT66_RS09155 (SHT66_09155) | - | 1839249..1839962 (-) | 714 | WP_116491850.1 | Rha family transcriptional regulator | - |
| SHT66_RS09160 (SHT66_09160) | - | 1840001..1840318 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| SHT66_RS09165 (SHT66_09165) | - | 1840324..1840515 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| SHT66_RS09170 (SHT66_09170) | - | 1840808..1841149 (+) | 342 | WP_002396615.1 | helix-turn-helix domain-containing protein | - |
| SHT66_RS09175 (SHT66_09175) | - | 1841154..1841801 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SHT66_RS09180 (SHT66_09180) | - | 1841919..1842683 (+) | 765 | WP_229077509.1 | LysM domain-containing protein | - |
| SHT66_RS09185 (SHT66_09185) | - | 1842698..1843027 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| SHT66_RS09190 (SHT66_09190) | - | 1843102..1844250 (+) | 1149 | WP_116491852.1 | site-specific integrase | - |
| SHT66_RS09195 (SHT66_09195) | comGD | 1844278..1844721 (-) | 444 | WP_116491816.1 | competence type IV pilus minor pilin ComGD | - |
| SHT66_RS09200 (SHT66_09200) | comGC/cglC | 1844718..1844993 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=903911 SHT66_RS09200 WP_002356991.1 1844718..1844993(-) (comGC/cglC) [Enterococcus faecalis strain ES-3-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=903911 SHT66_RS09200 WP_002356991.1 1844718..1844993(-) (comGC/cglC) [Enterococcus faecalis strain ES-3-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |