Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | R5H38_RS09250 | Genome accession | NZ_CP137602 |
| Coordinates | 1808249..1808644 (-) | Length | 131 a.a. |
| NCBI ID | WP_172036885.1 | Uniprot ID | - |
| Organism | Streptococcus parasuis strain 221006 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1742170..1807783 | 1808249..1808644 | flank | 466 |
Gene organization within MGE regions
Location: 1742170..1808644
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R5H38_RS08925 | rnhC | 1742223..1743113 (+) | 891 | WP_277837505.1 | ribonuclease HIII | - |
| R5H38_RS08930 | lepB | 1743127..1743756 (+) | 630 | WP_274504301.1 | signal peptidase I | - |
| R5H38_RS08935 | - | 1743819..1746308 (+) | 2490 | WP_318150595.1 | ATP-dependent RecD-like DNA helicase | - |
| R5H38_RS08940 | dinB | 1746463..1747530 (-) | 1068 | WP_318150596.1 | DNA polymerase IV | - |
| R5H38_RS08945 | pflB | 1747768..1750113 (+) | 2346 | WP_318150597.1 | formate C-acetyltransferase | - |
| R5H38_RS08950 | - | 1750296..1751105 (-) | 810 | WP_318150598.1 | COG3942 and LysM peptidoglycan-binding domain-containing protein | - |
| R5H38_RS08955 | - | 1751170..1751736 (-) | 567 | WP_318150599.1 | DUF1697 domain-containing protein | - |
| R5H38_RS08960 | - | 1751733..1752674 (-) | 942 | WP_318150600.1 | serine hydrolase domain-containing protein | - |
| R5H38_RS08965 | - | 1752671..1753405 (-) | 735 | WP_318150601.1 | CppA N-terminal domain-containing protein | - |
| R5H38_RS08970 | - | 1753598..1755865 (+) | 2268 | WP_318150602.1 | Xaa-Pro dipeptidyl-peptidase | - |
| R5H38_RS08975 | - | 1756031..1757193 (-) | 1163 | Protein_1741 | SIS domain-containing protein | - |
| R5H38_RS08980 | - | 1757554..1757853 (+) | 300 | WP_024403999.1 | YbaB/EbfC family nucleoid-associated protein | - |
| R5H38_RS08985 | - | 1757900..1759660 (-) | 1761 | WP_318150603.1 | glycerophosphodiester phosphodiesterase | - |
| R5H38_RS08990 | - | 1759740..1759976 (+) | 237 | WP_254451604.1 | hypothetical protein | - |
| R5H38_RS08995 | - | 1760021..1760329 (+) | 309 | WP_254451668.1 | GNAT family N-acetyltransferase | - |
| R5H38_RS09000 | - | 1760532..1761026 (-) | 495 | WP_217375195.1 | DUF536 domain-containing protein | - |
| R5H38_RS09010 | - | 1762539..1763981 (-) | 1443 | WP_318150605.1 | multicopper oxidase family protein | - |
| R5H38_RS09015 | - | 1764211..1764345 (-) | 135 | Protein_1749 | IS256 family transposase | - |
| R5H38_RS09020 | - | 1764608..1764769 (+) | 162 | Protein_1750 | multicopper oxidase domain-containing protein | - |
| R5H38_RS09025 | - | 1764849..1764911 (+) | 63 | WP_254451669.1 | multicopper oxidase domain-containing protein | - |
| R5H38_RS09030 | micA | 1764947..1765630 (+) | 684 | WP_099390332.1 | response regulator transcription factor | Regulator |
| R5H38_RS09035 | - | 1765627..1767024 (+) | 1398 | WP_318150606.1 | sensor histidine kinase | - |
| R5H38_RS09040 | - | 1767195..1768367 (-) | 1173 | WP_318150607.1 | YncE family protein | - |
| R5H38_RS09045 | - | 1768677..1768910 (-) | 234 | WP_043914326.1 | amino acid acetyltransferase | - |
| R5H38_RS09050 | lgt | 1768913..1769797 (-) | 885 | WP_014334283.1 | prolipoprotein diacylglyceryl transferase | - |
| R5H38_RS09055 | - | 1769841..1770233 (-) | 393 | WP_277844550.1 | M23 family metallopeptidase | - |
| R5H38_RS09060 | - | 1770552..1770755 (+) | 204 | WP_277844552.1 | adhesion protein | - |
| R5H38_RS09065 | - | 1770808..1771410 (+) | 603 | WP_318151032.1 | TIGR01906 family membrane protein | - |
| R5H38_RS09070 | - | 1771613..1772952 (+) | 1340 | Protein_1760 | ISL3 family transposase | - |
| R5H38_RS09075 | - | 1773090..1775252 (-) | 2163 | WP_277844554.1 | heavy metal translocating P-type ATPase | - |
| R5H38_RS09080 | tcrZ | 1775391..1775597 (-) | 207 | WP_002294571.1 | copper chaperone TcrZ | - |
| R5H38_RS10325 | - | 1775746..1776492 (-) | 747 | WP_412080683.1 | HAD-IC family P-type ATPase | - |
| R5H38_RS10330 | - | 1776524..1777312 (-) | 789 | WP_412080656.1 | HAD-IC family P-type ATPase | - |
| R5H38_RS10335 | - | 1777781..1777897 (-) | 117 | WP_412080684.1 | cation transporter | - |
| R5H38_RS10340 | - | 1778003..1778109 (-) | 107 | Protein_1766 | cation transporter | - |
| R5H38_RS09090 | - | 1778152..1778607 (-) | 456 | WP_318150608.1 | CopY/TcrY family copper transport repressor | - |
| R5H38_RS09095 | - | 1778897..1779118 (-) | 222 | WP_254451605.1 | replication initiator protein A | - |
| R5H38_RS09100 | - | 1779120..1779260 (-) | 141 | WP_318150609.1 | hypothetical protein | - |
| R5H38_RS09105 | - | 1779503..1780675 (+) | 1173 | WP_274504316.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| R5H38_RS09110 | - | 1780739..1781404 (+) | 666 | WP_412080685.1 | GNAT family N-acetyltransferase | - |
| R5H38_RS09115 | - | 1781485..1782184 (+) | 700 | Protein_1772 | ATP-binding cassette domain-containing protein | - |
| R5H38_RS10345 | - | 1782194..1783820 (+) | 1627 | Protein_1773 | hypothetical protein | - |
| R5H38_RS09130 | - | 1783858..1784880 (-) | 1023 | WP_130554973.1 | YeiH family protein | - |
| R5H38_RS09135 | - | 1784890..1785213 (-) | 324 | WP_130554972.1 | AzlD domain-containing protein | - |
| R5H38_RS09140 | - | 1785200..1785901 (-) | 702 | WP_318150611.1 | AzlC family ABC transporter permease | - |
| R5H38_RS09145 | - | 1786233..1787021 (-) | 789 | WP_277844565.1 | ABC transporter permease subunit | - |
| R5H38_RS09150 | - | 1787018..1787851 (-) | 834 | WP_277844567.1 | ABC transporter ATP-binding protein | - |
| R5H38_RS09155 | tsaD | 1787871..1788878 (-) | 1008 | WP_217375197.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD | - |
| R5H38_RS09160 | rimI | 1788868..1789308 (-) | 441 | WP_130554967.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
| R5H38_RS09165 | tsaB | 1789305..1789988 (-) | 684 | WP_277837578.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| R5H38_RS09170 | - | 1790198..1791443 (+) | 1246 | Protein_1782 | IS3 family transposase | - |
| R5H38_RS09175 | - | 1791634..1791756 (-) | 123 | WP_318150612.1 | hypothetical protein | - |
| R5H38_RS09180 | - | 1792072..1792302 (+) | 231 | WP_105126479.1 | RNA polymerase epsilon subunit | - |
| R5H38_RS09185 | rnjA | 1792306..1793985 (+) | 1680 | WP_274504324.1 | ribonuclease J1 | - |
| R5H38_RS09190 | glnA | 1794265..1795611 (-) | 1347 | WP_217374311.1 | type I glutamate--ammonia ligase | - |
| R5H38_RS09195 | - | 1795639..1796010 (-) | 372 | WP_024392055.1 | MerR family transcriptional regulator | - |
| R5H38_RS09200 | - | 1796086..1796601 (-) | 516 | WP_277837576.1 | FUSC family protein | - |
| R5H38_RS09205 | - | 1797146..1798345 (-) | 1200 | WP_277837575.1 | phosphoglycerate kinase | - |
| R5H38_RS09210 | - | 1798484..1799326 (-) | 843 | WP_318150613.1 | aldo/keto reductase | - |
| R5H38_RS09215 | - | 1799344..1800540 (-) | 1197 | WP_277837573.1 | iron-containing alcohol dehydrogenase | - |
| R5H38_RS09220 | gap | 1800728..1801738 (-) | 1011 | WP_217374316.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| R5H38_RS09225 | fusA | 1801965..1804046 (-) | 2082 | WP_289647113.1 | elongation factor G | - |
| R5H38_RS09230 | rpsG | 1804547..1805017 (-) | 471 | WP_105182784.1 | 30S ribosomal protein S7 | - |
| R5H38_RS09235 | rpsL | 1805034..1805447 (-) | 414 | WP_002940030.1 | 30S ribosomal protein S12 | - |
| R5H38_RS09240 | groL | 1805677..1807299 (-) | 1623 | WP_277837571.1 | chaperonin GroEL | - |
| R5H38_RS09245 | groES | 1807398..1807679 (-) | 282 | WP_277837570.1 | co-chaperone GroES | - |
| R5H38_RS09250 | ssbA | 1808249..1808644 (-) | 396 | WP_172036885.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14949.81 Da Isoelectric Point: 5.0026
>NTDB_id=899256 R5H38_RS09250 WP_172036885.1 1808249..1808644(-) (ssbA) [Streptococcus parasuis strain 221006]
MYNKIIAIGRLTAQPELTQTPNGKNLTRVTIAVNRRFKTENGEREADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTR
KYEKDGNNHYVTEILGQSFQLLESRAQRAMRENNTNDDLADVILEEEELPF
MYNKIIAIGRLTAQPELTQTPNGKNLTRVTIAVNRRFKTENGEREADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTR
KYEKDGNNHYVTEILGQSFQLLESRAQRAMRENNTNDDLADVILEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=899256 R5H38_RS09250 WP_172036885.1 1808249..1808644(-) (ssbA) [Streptococcus parasuis strain 221006]
ATGTATAATAAAATCATTGCAATCGGTCGCTTGACGGCCCAACCGGAACTGACTCAAACGCCAAATGGCAAAAATCTGAC
TCGTGTCACAATTGCTGTGAACCGCCGTTTCAAGACAGAAAATGGCGAACGTGAGGCAGATTTTCTCAATGTTATTTTCT
GGGGAAAACTGGCGGAAACACTTGTCTCCTATGGCAGCAAGGGCAGTCTGATTTCTATTGACGGTGAGTTGCGGACGCGA
AAATACGAAAAAGACGGCAACAACCACTATGTGACAGAGATTCTAGGCCAATCTTTCCAATTACTAGAAAGTCGTGCTCA
ACGTGCTATGCGTGAAAATAATACGAATGATGATTTGGCGGATGTGATTTTGGAAGAAGAAGAATTGCCGTTTTGA
ATGTATAATAAAATCATTGCAATCGGTCGCTTGACGGCCCAACCGGAACTGACTCAAACGCCAAATGGCAAAAATCTGAC
TCGTGTCACAATTGCTGTGAACCGCCGTTTCAAGACAGAAAATGGCGAACGTGAGGCAGATTTTCTCAATGTTATTTTCT
GGGGAAAACTGGCGGAAACACTTGTCTCCTATGGCAGCAAGGGCAGTCTGATTTCTATTGACGGTGAGTTGCGGACGCGA
AAATACGAAAAAGACGGCAACAACCACTATGTGACAGAGATTCTAGGCCAATCTTTCCAATTACTAGAAAGTCGTGCTCA
ACGTGCTATGCGTGAAAATAATACGAATGATGATTTGGCGGATGTGATTTTGGAAGAAGAAGAATTGCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
74.046 |
100 |
0.74 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
73.282 |
100 |
0.733 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis SK321 |
69.466 |
100 |
0.695 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
63.393 |
85.496 |
0.542 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.363 |
86.26 |
0.374 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
46.226 |
80.916 |
0.374 |