Detailed information    

insolico Bioinformatically predicted

Overview


Name   micA   Type   Regulator
Locus tag   R5H38_RS09030 Genome accession   NZ_CP137602
Coordinates   1764947..1765630 (+) Length   227 a.a.
NCBI ID   WP_099390332.1    Uniprot ID   -
Organism   Streptococcus parasuis strain 221006     
Function   repress competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1742170..1807783 1764947..1765630 within 0
IScluster/Tn 1761353..1764345 1764947..1765630 flank 602


Gene organization within MGE regions


Location: 1742170..1807783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R5H38_RS08925 rnhC 1742223..1743113 (+) 891 WP_277837505.1 ribonuclease HIII -
  R5H38_RS08930 lepB 1743127..1743756 (+) 630 WP_274504301.1 signal peptidase I -
  R5H38_RS08935 - 1743819..1746308 (+) 2490 WP_318150595.1 ATP-dependent RecD-like DNA helicase -
  R5H38_RS08940 dinB 1746463..1747530 (-) 1068 WP_318150596.1 DNA polymerase IV -
  R5H38_RS08945 pflB 1747768..1750113 (+) 2346 WP_318150597.1 formate C-acetyltransferase -
  R5H38_RS08950 - 1750296..1751105 (-) 810 WP_318150598.1 COG3942 and LysM peptidoglycan-binding domain-containing protein -
  R5H38_RS08955 - 1751170..1751736 (-) 567 WP_318150599.1 DUF1697 domain-containing protein -
  R5H38_RS08960 - 1751733..1752674 (-) 942 WP_318150600.1 serine hydrolase domain-containing protein -
  R5H38_RS08965 - 1752671..1753405 (-) 735 WP_318150601.1 CppA N-terminal domain-containing protein -
  R5H38_RS08970 - 1753598..1755865 (+) 2268 WP_318150602.1 Xaa-Pro dipeptidyl-peptidase -
  R5H38_RS08975 - 1756031..1757193 (-) 1163 Protein_1741 SIS domain-containing protein -
  R5H38_RS08980 - 1757554..1757853 (+) 300 WP_024403999.1 YbaB/EbfC family nucleoid-associated protein -
  R5H38_RS08985 - 1757900..1759660 (-) 1761 WP_318150603.1 glycerophosphodiester phosphodiesterase -
  R5H38_RS08990 - 1759740..1759976 (+) 237 WP_254451604.1 hypothetical protein -
  R5H38_RS08995 - 1760021..1760329 (+) 309 WP_254451668.1 GNAT family N-acetyltransferase -
  R5H38_RS09000 - 1760532..1761026 (-) 495 WP_217375195.1 DUF536 domain-containing protein -
  R5H38_RS09010 - 1762539..1763981 (-) 1443 WP_318150605.1 multicopper oxidase family protein -
  R5H38_RS09015 - 1764211..1764345 (-) 135 Protein_1749 IS256 family transposase -
  R5H38_RS09020 - 1764608..1764769 (+) 162 Protein_1750 multicopper oxidase domain-containing protein -
  R5H38_RS09025 - 1764849..1764911 (+) 63 WP_254451669.1 multicopper oxidase domain-containing protein -
  R5H38_RS09030 micA 1764947..1765630 (+) 684 WP_099390332.1 response regulator transcription factor Regulator
  R5H38_RS09035 - 1765627..1767024 (+) 1398 WP_318150606.1 sensor histidine kinase -
  R5H38_RS09040 - 1767195..1768367 (-) 1173 WP_318150607.1 YncE family protein -
  R5H38_RS09045 - 1768677..1768910 (-) 234 WP_043914326.1 amino acid acetyltransferase -
  R5H38_RS09050 lgt 1768913..1769797 (-) 885 WP_014334283.1 prolipoprotein diacylglyceryl transferase -
  R5H38_RS09055 - 1769841..1770233 (-) 393 WP_277844550.1 M23 family metallopeptidase -
  R5H38_RS09060 - 1770552..1770755 (+) 204 WP_277844552.1 adhesion protein -
  R5H38_RS09065 - 1770808..1771410 (+) 603 WP_318151032.1 TIGR01906 family membrane protein -
  R5H38_RS09070 - 1771613..1772952 (+) 1340 Protein_1760 ISL3 family transposase -
  R5H38_RS09075 - 1773090..1775252 (-) 2163 WP_277844554.1 heavy metal translocating P-type ATPase -
  R5H38_RS09080 tcrZ 1775391..1775597 (-) 207 WP_002294571.1 copper chaperone TcrZ -
  R5H38_RS10325 - 1775746..1776492 (-) 747 WP_412080683.1 HAD-IC family P-type ATPase -
  R5H38_RS10330 - 1776524..1777312 (-) 789 WP_412080656.1 HAD-IC family P-type ATPase -
  R5H38_RS10335 - 1777781..1777897 (-) 117 WP_412080684.1 cation transporter -
  R5H38_RS10340 - 1778003..1778109 (-) 107 Protein_1766 cation transporter -
  R5H38_RS09090 - 1778152..1778607 (-) 456 WP_318150608.1 CopY/TcrY family copper transport repressor -
  R5H38_RS09095 - 1778897..1779118 (-) 222 WP_254451605.1 replication initiator protein A -
  R5H38_RS09100 - 1779120..1779260 (-) 141 WP_318150609.1 hypothetical protein -
  R5H38_RS09105 - 1779503..1780675 (+) 1173 WP_274504316.1 NAD(P)/FAD-dependent oxidoreductase -
  R5H38_RS09110 - 1780739..1781404 (+) 666 WP_412080685.1 GNAT family N-acetyltransferase -
  R5H38_RS09115 - 1781485..1782184 (+) 700 Protein_1772 ATP-binding cassette domain-containing protein -
  R5H38_RS10345 - 1782194..1783820 (+) 1627 Protein_1773 hypothetical protein -
  R5H38_RS09130 - 1783858..1784880 (-) 1023 WP_130554973.1 YeiH family protein -
  R5H38_RS09135 - 1784890..1785213 (-) 324 WP_130554972.1 AzlD domain-containing protein -
  R5H38_RS09140 - 1785200..1785901 (-) 702 WP_318150611.1 AzlC family ABC transporter permease -
  R5H38_RS09145 - 1786233..1787021 (-) 789 WP_277844565.1 ABC transporter permease subunit -
  R5H38_RS09150 - 1787018..1787851 (-) 834 WP_277844567.1 ABC transporter ATP-binding protein -
  R5H38_RS09155 tsaD 1787871..1788878 (-) 1008 WP_217375197.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD -
  R5H38_RS09160 rimI 1788868..1789308 (-) 441 WP_130554967.1 ribosomal protein S18-alanine N-acetyltransferase -
  R5H38_RS09165 tsaB 1789305..1789988 (-) 684 WP_277837578.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB -
  R5H38_RS09170 - 1790198..1791443 (+) 1246 Protein_1782 IS3 family transposase -
  R5H38_RS09175 - 1791634..1791756 (-) 123 WP_318150612.1 hypothetical protein -
  R5H38_RS09180 - 1792072..1792302 (+) 231 WP_105126479.1 RNA polymerase epsilon subunit -
  R5H38_RS09185 rnjA 1792306..1793985 (+) 1680 WP_274504324.1 ribonuclease J1 -
  R5H38_RS09190 glnA 1794265..1795611 (-) 1347 WP_217374311.1 type I glutamate--ammonia ligase -
  R5H38_RS09195 - 1795639..1796010 (-) 372 WP_024392055.1 MerR family transcriptional regulator -
  R5H38_RS09200 - 1796086..1796601 (-) 516 WP_277837576.1 FUSC family protein -
  R5H38_RS09205 - 1797146..1798345 (-) 1200 WP_277837575.1 phosphoglycerate kinase -
  R5H38_RS09210 - 1798484..1799326 (-) 843 WP_318150613.1 aldo/keto reductase -
  R5H38_RS09215 - 1799344..1800540 (-) 1197 WP_277837573.1 iron-containing alcohol dehydrogenase -
  R5H38_RS09220 gap 1800728..1801738 (-) 1011 WP_217374316.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  R5H38_RS09225 fusA 1801965..1804046 (-) 2082 WP_289647113.1 elongation factor G -
  R5H38_RS09230 rpsG 1804547..1805017 (-) 471 WP_105182784.1 30S ribosomal protein S7 -
  R5H38_RS09235 rpsL 1805034..1805447 (-) 414 WP_002940030.1 30S ribosomal protein S12 -
  R5H38_RS09240 groL 1805677..1807299 (-) 1623 WP_277837571.1 chaperonin GroEL -
  R5H38_RS09245 groES 1807398..1807679 (-) 282 WP_277837570.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 227 a.a.        Molecular weight: 25664.71 Da        Isoelectric Point: 4.9111

>NTDB_id=899255 R5H38_RS09030 WP_099390332.1 1764947..1765630(+) (micA) [Streptococcus parasuis strain 221006]
MKILIVDDEASILDIVEAYLSAKGYQVFRALSGNEALTKVDVVQPDLIVLDLMLPGLSGLEVCKKIRDSSTVPIIMLTAK
TAEKDILEGLSLGADDYITKPFSPKELVARVETVLRRVQPEYREEKWSFEEGLLVIYPDRKQVFKQGEEIILTPTEYALL
ALLASHPKRLFSREQLLDAVKGLDFDGTDRVIDTHIKNIRQKIEDDTRNPYFILTAYGMGYRFGGQK

Nucleotide


Download         Length: 684 bp        

>NTDB_id=899255 R5H38_RS09030 WP_099390332.1 1764947..1765630(+) (micA) [Streptococcus parasuis strain 221006]
GTGAAGATTTTAATTGTGGACGACGAAGCAAGCATTCTGGATATCGTGGAAGCCTATTTGAGTGCAAAAGGCTATCAAGT
GTTTCGCGCTTTGAGCGGAAACGAGGCTTTAACAAAGGTTGATGTTGTCCAACCTGACTTGATTGTGTTGGATCTCATGC
TGCCTGGTTTATCTGGCCTCGAAGTCTGTAAAAAAATAAGGGACTCCTCCACTGTACCGATTATCATGTTGACTGCGAAA
ACAGCCGAAAAAGATATCTTGGAAGGGTTAAGCCTGGGGGCTGATGACTACATCACAAAACCATTCAGCCCGAAAGAGCT
GGTTGCTCGGGTCGAAACCGTTTTACGCCGTGTCCAACCAGAATACCGAGAAGAAAAGTGGTCTTTCGAAGAAGGTTTGC
TGGTTATCTACCCGGATCGAAAACAAGTATTCAAACAAGGTGAAGAAATCATTTTGACCCCGACCGAGTATGCTTTATTA
GCCCTTCTGGCCTCACATCCAAAGCGCCTATTTTCACGGGAACAGCTGCTGGACGCTGTGAAAGGACTCGATTTTGATGG
AACGGATCGGGTGATCGATACCCACATCAAAAATATCCGTCAAAAAATTGAGGACGACACGCGCAACCCCTACTTCATCT
TAACCGCATATGGAATGGGGTATCGATTTGGTGGTCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  micA Streptococcus pneumoniae Cp1015

48.673

99.559

0.485

  vicR Streptococcus mutans UA159

48.458

100

0.485

  scnR Streptococcus mutans UA159

38.865

100

0.392

  covR Lactococcus lactis subsp. lactis strain DGCC12653

38.117

98.238

0.374

  covR Streptococcus salivarius strain HSISS4

37.668

98.238

0.37