Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R4B61_RS00465 | Genome accession | NZ_CP137138 |
| Coordinates | 82603..83019 (-) | Length | 138 a.a. |
| NCBI ID | WP_413627709.1 | Uniprot ID | - |
| Organism | Fructilactobacillus vespulae strain Mu01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 54958..94533 | 82603..83019 | within | 0 |
Gene organization within MGE regions
Location: 54958..94533
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4B61_RS00260 (R4B61_00260) | - | 54958..55212 (-) | 255 | WP_413627669.1 | hypothetical protein | - |
| R4B61_RS00265 (R4B61_00265) | - | 55675..56679 (-) | 1005 | WP_413627670.1 | GH25 family lysozyme | - |
| R4B61_RS00270 (R4B61_00270) | - | 56679..57062 (-) | 384 | WP_413627671.1 | phage holin, LLH family | - |
| R4B61_RS00275 (R4B61_00275) | - | 57062..57319 (-) | 258 | WP_413627672.1 | hypothetical protein | - |
| R4B61_RS00280 (R4B61_00280) | - | 57316..57705 (-) | 390 | WP_413627673.1 | hypothetical protein | - |
| R4B61_RS00285 (R4B61_00285) | - | 57739..57870 (-) | 132 | WP_413627674.1 | XkdX family protein | - |
| R4B61_RS00290 (R4B61_00290) | - | 57872..58150 (-) | 279 | WP_413627675.1 | hypothetical protein | - |
| R4B61_RS00295 (R4B61_00295) | - | 58169..59170 (-) | 1002 | WP_413627676.1 | hypothetical protein | - |
| R4B61_RS00300 (R4B61_00300) | - | 59170..59712 (-) | 543 | WP_413627677.1 | putative phage tail protein | - |
| R4B61_RS00305 (R4B61_00305) | - | 59705..60847 (-) | 1143 | WP_413627678.1 | baseplate J/gp47 family protein | - |
| R4B61_RS00310 (R4B61_00310) | - | 60837..61223 (-) | 387 | WP_413627679.1 | DUF2634 domain-containing protein | - |
| R4B61_RS00315 (R4B61_00315) | - | 61223..61564 (-) | 342 | WP_413627680.1 | DUF2577 family protein | - |
| R4B61_RS00320 (R4B61_00320) | - | 61561..62568 (-) | 1008 | WP_413627681.1 | hypothetical protein | - |
| R4B61_RS00325 (R4B61_00325) | - | 62577..63287 (-) | 711 | WP_413627682.1 | hypothetical protein | - |
| R4B61_RS00330 (R4B61_00330) | - | 63302..66709 (-) | 3408 | WP_413627683.1 | tape measure protein | - |
| R4B61_RS00335 (R4B61_00335) | - | 66969..67367 (-) | 399 | WP_413627684.1 | phage tail assembly chaperone | - |
| R4B61_RS00340 (R4B61_00340) | - | 67387..67836 (-) | 450 | WP_413627685.1 | phage tail tube protein | - |
| R4B61_RS00345 (R4B61_00345) | - | 67848..69215 (-) | 1368 | WP_413627686.1 | phage tail sheath family protein | - |
| R4B61_RS00350 (R4B61_00350) | - | 69218..69472 (-) | 255 | WP_413627687.1 | hypothetical protein | - |
| R4B61_RS00355 (R4B61_00355) | - | 69488..69871 (-) | 384 | WP_413627688.1 | DUF6838 family protein | - |
| R4B61_RS00360 (R4B61_00360) | - | 69868..70275 (-) | 408 | WP_413627689.1 | HK97 gp10 family phage protein | - |
| R4B61_RS00365 (R4B61_00365) | - | 70275..70661 (-) | 387 | WP_413627690.1 | hypothetical protein | - |
| R4B61_RS00370 (R4B61_00370) | - | 70655..71023 (-) | 369 | WP_413627691.1 | hypothetical protein | - |
| R4B61_RS00375 (R4B61_00375) | - | 71033..71929 (-) | 897 | WP_413627692.1 | hypothetical protein | - |
| R4B61_RS00380 (R4B61_00380) | - | 71943..72485 (-) | 543 | WP_413627693.1 | phage scaffolding protein | - |
| R4B61_RS00385 (R4B61_00385) | - | 72619..72825 (-) | 207 | WP_413627694.1 | hypothetical protein | - |
| R4B61_RS00390 (R4B61_00390) | - | 72815..74140 (-) | 1326 | WP_413627695.1 | minor capsid protein | - |
| R4B61_RS00395 (R4B61_00395) | - | 74152..75546 (-) | 1395 | WP_413627696.1 | phage portal protein | - |
| R4B61_RS00400 (R4B61_00400) | - | 75560..76843 (-) | 1284 | WP_413627697.1 | PBSX family phage terminase large subunit | - |
| R4B61_RS00405 (R4B61_00405) | - | 76821..77630 (-) | 810 | WP_413627698.1 | terminase small subunit | - |
| R4B61_RS00410 (R4B61_00410) | - | 77926..78345 (-) | 420 | WP_413627699.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| R4B61_RS00415 (R4B61_00415) | - | 78424..78651 (-) | 228 | WP_413627700.1 | hypothetical protein | - |
| R4B61_RS00420 (R4B61_00420) | - | 78651..78902 (-) | 252 | WP_413627701.1 | hypothetical protein | - |
| R4B61_RS00425 (R4B61_00425) | - | 78895..79134 (-) | 240 | WP_413627702.1 | hypothetical protein | - |
| R4B61_RS00430 (R4B61_00430) | - | 79127..79426 (-) | 300 | WP_413627703.1 | hypothetical protein | - |
| R4B61_RS00435 (R4B61_00435) | - | 79431..79916 (-) | 486 | WP_413627704.1 | hypothetical protein | - |
| R4B61_RS00440 (R4B61_00440) | - | 79934..80182 (-) | 249 | WP_413627705.1 | hypothetical protein | - |
| R4B61_RS00445 (R4B61_00445) | - | 80185..80559 (-) | 375 | WP_413627706.1 | DUF1064 domain-containing protein | - |
| R4B61_RS00450 (R4B61_00450) | - | 80543..80911 (-) | 369 | WP_413627707.1 | hypothetical protein | - |
| R4B61_RS00455 (R4B61_00455) | - | 81071..81874 (-) | 804 | WP_413628261.1 | ATP-binding protein | - |
| R4B61_RS00460 (R4B61_00460) | - | 81855..82592 (-) | 738 | WP_413627708.1 | DnaD domain protein | - |
| R4B61_RS00465 (R4B61_00465) | ssb | 82603..83019 (-) | 417 | WP_413627709.1 | single-stranded DNA-binding protein | Machinery gene |
| R4B61_RS00470 (R4B61_00470) | - | 83019..83186 (-) | 168 | WP_413627710.1 | hypothetical protein | - |
| R4B61_RS00475 (R4B61_00475) | - | 83152..83280 (-) | 129 | WP_413627711.1 | hypothetical protein | - |
| R4B61_RS00480 (R4B61_00480) | - | 83397..83567 (-) | 171 | WP_413627712.1 | hypothetical protein | - |
| R4B61_RS00485 (R4B61_00485) | - | 83567..83830 (-) | 264 | WP_413627713.1 | hypothetical protein | - |
| R4B61_RS00490 (R4B61_00490) | - | 83848..83982 (-) | 135 | WP_413627714.1 | hypothetical protein | - |
| R4B61_RS00495 (R4B61_00495) | - | 84069..84866 (-) | 798 | WP_413627715.1 | ORF6N domain-containing protein | - |
| R4B61_RS00500 (R4B61_00500) | - | 84877..85074 (-) | 198 | WP_413627716.1 | XRE family transcriptional regulator | - |
| R4B61_RS00505 (R4B61_00505) | - | 85304..85645 (+) | 342 | WP_413627717.1 | helix-turn-helix domain-containing protein | - |
| R4B61_RS00510 (R4B61_00510) | - | 85648..86400 (+) | 753 | WP_413627718.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R4B61_RS00515 (R4B61_00515) | - | 86449..87042 (+) | 594 | WP_413627719.1 | hypothetical protein | - |
| R4B61_RS00520 (R4B61_00520) | - | 87123..88244 (+) | 1122 | WP_413627720.1 | tyrosine-type recombinase/integrase | - |
| R4B61_RS00545 (R4B61_00545) | - | 93769..94533 (-) | 765 | WP_413627721.1 | DUF4811 domain-containing protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15517.11 Da Isoelectric Point: 4.9533
>NTDB_id=896460 R4B61_RS00465 WP_413627709.1 82603..83019(-) (ssb) [Fructilactobacillus vespulae strain Mu01]
MINTTVLTGRLTRDVELRYTQKGDTNGTFTLAVDRRFKNANGDREADFVNCVIWRKSAENLANFVGKGSLIGVEGRLQTR
NYENKQGQRVFVTEVVVENFTLLDTRADSSNRTGYQNNQSSPFSGGDQIDVSEEELPF
MINTTVLTGRLTRDVELRYTQKGDTNGTFTLAVDRRFKNANGDREADFVNCVIWRKSAENLANFVGKGSLIGVEGRLQTR
NYENKQGQRVFVTEVVVENFTLLDTRADSSNRTGYQNNQSSPFSGGDQIDVSEEELPF
Nucleotide
Download Length: 417 bp
>NTDB_id=896460 R4B61_RS00465 WP_413627709.1 82603..83019(-) (ssb) [Fructilactobacillus vespulae strain Mu01]
ATGATTAACACAACAGTTTTAACAGGACGACTAACAAGAGATGTGGAATTAAGATATACGCAAAAAGGTGATACAAACGG
AACATTTACATTGGCTGTTGATAGACGTTTTAAGAACGCAAATGGTGACCGTGAAGCAGATTTCGTTAATTGCGTTATCT
GGCGTAAATCAGCTGAAAATTTAGCTAATTTCGTTGGCAAGGGATCACTAATCGGAGTTGAAGGACGTTTGCAAACTAGA
AACTATGAAAACAAGCAAGGACAGCGTGTCTTTGTTACGGAAGTAGTAGTTGAAAACTTCACCTTACTAGATACCAGAGC
CGACTCATCTAATAGAACTGGCTACCAAAATAATCAATCTAGTCCATTTAGTGGTGGCGACCAAATCGATGTCAGTGAGG
AGGAACTTCCATTTTAA
ATGATTAACACAACAGTTTTAACAGGACGACTAACAAGAGATGTGGAATTAAGATATACGCAAAAAGGTGATACAAACGG
AACATTTACATTGGCTGTTGATAGACGTTTTAAGAACGCAAATGGTGACCGTGAAGCAGATTTCGTTAATTGCGTTATCT
GGCGTAAATCAGCTGAAAATTTAGCTAATTTCGTTGGCAAGGGATCACTAATCGGAGTTGAAGGACGTTTGCAAACTAGA
AACTATGAAAACAAGCAAGGACAGCGTGTCTTTGTTACGGAAGTAGTAGTTGAAAACTTCACCTTACTAGATACCAGAGC
CGACTCATCTAATAGAACTGGCTACCAAAATAATCAATCTAGTCCATTTAGTGGTGGCGACCAAATCGATGTCAGTGAGG
AGGAACTTCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.674 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.256 |
100 |
0.601 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.857 |
100 |
0.486 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.857 |
100 |
0.486 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
47.143 |
100 |
0.478 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
47.143 |
100 |
0.478 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
47.143 |
100 |
0.478 |
| ssbB/cilA | Streptococcus mitis SK321 |
47.143 |
100 |
0.478 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.203 |
100 |
0.442 |
| ssbA | Streptococcus mutans UA159 |
43.478 |
100 |
0.435 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
76.812 |
0.413 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.17 |
76.812 |
0.362 |