Detailed information
Overview
| Name | ssbB/cilA | Type | Machinery gene |
| Locus tag | R4702_RS07330 | Genome accession | NZ_CP137106 |
| Coordinates | 1422054..1422449 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282467.1 | Uniprot ID | A0A098Z0L0 |
| Organism | Streptococcus pneumoniae strain 16P4028 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1364782..1424214 | 1422054..1422449 | within | 0 |
Gene organization within MGE regions
Location: 1364782..1424214
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4702_RS06995 | rpoC | 1365988..1369665 (+) | 3678 | WP_000228766.1 | DNA-directed RNA polymerase subunit beta' | - |
| R4702_RS07000 | ndk | 1369776..1370189 (+) | 414 | WP_000438285.1 | nucleoside-diphosphate kinase | - |
| R4702_RS07005 | - | 1371117..1371749 (-) | 633 | WP_000571426.1 | ABC transporter ATP-binding protein | - |
| R4702_RS07010 | - | 1371751..1373766 (-) | 2016 | WP_000732396.1 | DUF1430 domain-containing protein | - |
| R4702_RS07015 | - | 1373911..1374081 (-) | 171 | WP_000742180.1 | PhrA family quorum-sensing system peptide | - |
| R4702_RS07020 | - | 1374270..1375133 (+) | 864 | WP_001093620.1 | helix-turn-helix domain-containing protein | - |
| R4702_RS07025 | comM | 1375516..1376136 (+) | 621 | WP_000839909.1 | hypothetical protein | Regulator |
| R4702_RS07030 | tsaE | 1376222..1376665 (+) | 444 | WP_000288230.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| R4702_RS07035 | - | 1376655..1377173 (+) | 519 | WP_000455536.1 | GNAT family N-acetyltransferase | - |
| R4702_RS07040 | brpA | 1377181..1378197 (+) | 1017 | WP_000239278.1 | biofilm formation/cell division transcriptional regulator BrpA | - |
| R4702_RS07045 | cinA | 1378281..1379537 (+) | 1257 | WP_000642707.1 | competence/damage-inducible protein A | Machinery gene |
| R4702_RS07050 | recA | 1379592..1380758 (+) | 1167 | WP_001085463.1 | recombinase RecA | Machinery gene |
| R4702_RS07055 | - | 1381069..1382439 (+) | 1371 | WP_317809564.1 | MATE family efflux transporter | - |
| R4702_RS07060 | lytA | 1382815..1383771 (+) | 957 | WP_000405234.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| R4702_RS07065 | - | 1384433..1384747 (+) | 315 | WP_050205552.1 | YdcP family protein | - |
| R4702_RS07070 | - | 1384763..1385149 (+) | 387 | WP_202484503.1 | YdcP family protein | - |
| R4702_RS07075 | - | 1385189..1386583 (+) | 1395 | WP_317809573.1 | FtsK/SpoIIIE domain-containing protein | - |
| R4702_RS07080 | - | 1386589..1387026 (+) | 438 | WP_015646595.1 | hypothetical protein | - |
| R4702_RS07085 | - | 1387055..1387180 (+) | 126 | WP_075218791.1 | conjugal transfer protein | - |
| R4702_RS07090 | mobT | 1387203..1388405 (+) | 1203 | Protein_1377 | MobT family relaxase | - |
| R4702_RS07095 | - | 1388454..1388621 (+) | 168 | WP_000502600.1 | MLS leader peptide | - |
| R4702_RS07100 | - | 1388670..1388753 (+) | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| R4702_RS07105 | erm(B) | 1388878..1389615 (+) | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| R4702_RS07110 | - | 1389872..1391119 (-) | 1248 | WP_000019067.1 | ISL3 family transposase | - |
| R4702_RS07115 | - | 1391299..1391520 (+) | 222 | WP_001009056.1 | hypothetical protein | - |
| R4702_RS07120 | - | 1391637..1392134 (+) | 498 | WP_000342539.1 | antirestriction protein ArdA | - |
| R4702_RS07125 | - | 1392223..1392615 (+) | 393 | WP_002345009.1 | conjugal transfer protein | - |
| R4702_RS07130 | - | 1392599..1395046 (+) | 2448 | WP_050197513.1 | ATP-binding protein | - |
| R4702_RS07135 | - | 1395049..1397226 (+) | 2178 | WP_000804748.1 | CD3337/EF1877 family mobilome membrane protein | - |
| R4702_RS07140 | - | 1397223..1398224 (+) | 1002 | WP_000769868.1 | lysozyme family protein | - |
| R4702_RS07145 | - | 1398221..1399153 (+) | 933 | WP_001224318.1 | conjugal transfer protein | - |
| R4702_RS11005 | - | 1399467..1399514 (+) | 48 | Protein_1389 | hypothetical protein | - |
| R4702_RS07155 | tet(M) | 1399530..1401449 (+) | 1920 | WP_044812736.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| R4702_RS07160 | - | 1401568..1401735 (+) | 168 | WP_000336323.1 | cysteine-rich KTR domain-containing protein | - |
| R4702_RS07165 | - | 1401795..1402148 (-) | 354 | WP_001227347.1 | helix-turn-helix transcriptional regulator | - |
| R4702_RS07170 | - | 1402653..1403075 (+) | 423 | WP_000804599.1 | sigma-70 family RNA polymerase sigma factor | - |
| R4702_RS07175 | - | 1403072..1403302 (+) | 231 | WP_000857133.1 | helix-turn-helix domain-containing protein | - |
| R4702_RS07180 | - | 1403527..1403775 (-) | 249 | Protein_1395 | hypothetical protein | - |
| R4702_RS07185 | - | 1403759..1403962 (+) | 204 | WP_000814512.1 | excisionase | - |
| R4702_RS07190 | - | 1404044..1405261 (+) | 1218 | WP_219590604.1 | tyrosine-type recombinase/integrase | - |
| R4702_RS07195 | - | 1405484..1405645 (+) | 162 | WP_001055999.1 | helix-turn-helix domain-containing protein | - |
| R4702_RS07200 | - | 1405632..1405838 (+) | 207 | WP_000366093.1 | hypothetical protein | - |
| R4702_RS07205 | - | 1405884..1406240 (+) | 357 | Protein_1400 | ImmA/IrrE family metallo-endopeptidase | - |
| R4702_RS07210 | - | 1406371..1406796 (+) | 426 | WP_000204059.1 | hypothetical protein | - |
| R4702_RS07215 | - | 1407204..1407788 (+) | 585 | WP_001101199.1 | hypothetical protein | - |
| R4702_RS07220 | - | 1407792..1407989 (+) | 198 | WP_000890144.1 | hypothetical protein | - |
| R4702_RS07225 | - | 1407979..1408530 (+) | 552 | WP_001111259.1 | hypothetical protein | - |
| R4702_RS07230 | - | 1408589..1408849 (+) | 261 | WP_001209200.1 | hypothetical protein | - |
| R4702_RS07235 | - | 1409613..1409903 (-) | 291 | Protein_1406 | transposase family protein | - |
| R4702_RS11010 | - | 1409881..1410012 (-) | 132 | WP_001821842.1 | hypothetical protein | - |
| R4702_RS07240 | - | 1410137..1410595 (+) | 459 | WP_000186955.1 | DUF4231 domain-containing protein | - |
| R4702_RS07245 | - | 1410608..1411216 (+) | 609 | WP_000083614.1 | hypothetical protein | - |
| R4702_RS07250 | - | 1411209..1411619 (+) | 411 | WP_000595758.1 | hypothetical protein | - |
| R4702_RS07255 | ply | 1411630..1413045 (+) | 1416 | WP_001284361.1 | cholesterol-dependent cytolysin pneumolysin | - |
| R4702_RS07260 | - | 1413926..1414642 (+) | 717 | WP_000532876.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| R4702_RS07265 | - | 1414766..1415237 (+) | 472 | Protein_1413 | MarR family winged helix-turn-helix transcriptional regulator | - |
| R4702_RS07270 | - | 1415254..1416075 (+) | 822 | Protein_1414 | ABC transporter permease | - |
| R4702_RS07275 | rcrQ | 1416130..1417113 (+) | 984 | WP_224782081.1 | ABC transporter ATP-binding protein/permease | Regulator |
| R4702_RS07280 | - | 1417179..1417541 (+) | 363 | WP_000078805.1 | DUF2200 domain-containing protein | - |
| R4702_RS07285 | - | 1417538..1418041 (+) | 504 | WP_044789202.1 | phosphatase PAP2 family protein | - |
| R4702_RS07290 | - | 1418155..1418601 (+) | 447 | WP_000776589.1 | LytTR family DNA-binding domain-containing protein | - |
| R4702_RS07295 | - | 1418607..1419281 (+) | 675 | WP_050148694.1 | LiaF transmembrane domain-containing protein | - |
| R4702_RS07300 | - | 1419442..1419633 (+) | 192 | WP_000291826.1 | cell wall-binding protein | - |
| R4702_RS07305 | - | 1419658..1419720 (+) | 63 | WP_219300018.1 | hypothetical protein | - |
| R4702_RS07310 | - | 1419918..1420217 (+) | 300 | WP_001013974.1 | DUF4651 domain-containing protein | - |
| R4702_RS07315 | - | 1420214..1420531 (+) | 318 | WP_000615772.1 | thioredoxin family protein | - |
| R4702_RS07320 | ytpR | 1420547..1421173 (+) | 627 | WP_000578289.1 | YtpR family tRNA-binding protein | - |
| R4702_RS07325 | - | 1421215..1421976 (+) | 762 | WP_001107757.1 | SDR family oxidoreductase | - |
| R4702_RS07330 | ssbB/cilA | 1422054..1422449 (+) | 396 | WP_000282467.1 | single-stranded DNA-binding protein | Machinery gene |
| R4702_RS07335 | groES | 1422719..1423003 (+) | 285 | WP_000917339.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409
>NTDB_id=895581 R4702_RS07330 WP_000282467.1 1422054..1422449(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16P4028]
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=895581 R4702_RS07330 WP_000282467.1 1422054..1422449(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16P4028]
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTAACAGGATTCCAACTCTTGGAAAGTCGTGCTCA
ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTAGTCTTGGAAGAGGAAGAATTGCCATTTTAA
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTAACAGGATTCCAACTCTTGGAAAGTCGTGCTCA
ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTAGTCTTGGAAGAGGAAGAATTGCCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB/cilA | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
99.237 |
100 |
0.992 |
| ssbB/cilA | Streptococcus mitis SK321 |
98.473 |
100 |
0.985 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
98.473 |
100 |
0.985 |
| ssbA | Streptococcus mutans UA159 |
74.809 |
100 |
0.748 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
70.229 |
100 |
0.702 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.821 |
85.496 |
0.511 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.903 |
86.26 |
0.405 |