NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	R4709_RS07235	Genome accession	NZ_CP137102
Coordinates	1397005..1397400 (+)	Length	131 a.a.
NCBI ID	WP_000282442.1	Uniprot ID	-
Organism	Streptococcus pneumoniae strain 16H3071-2
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1392005..1402400

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4709_RS07185	-	1392139..1392501 (+)	363	WP_000078805.1	DUF2200 domain-containing protein	-
R4709_RS07190	-	1392498..1393001 (+)	504	WP_000800944.1	phosphatase PAP2 family protein	-
R4709_RS07195	-	1393115..1393561 (+)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
R4709_RS07200	-	1393567..1394241 (+)	675	WP_000725744.1	LiaF transmembrane domain-containing protein	-
R4709_RS07205	-	1394402..1394593 (+)	192	WP_000291826.1	cell wall-binding protein	-
R4709_RS07210	-	1394600..1394680 (+)	81	WP_223200442.1	hypothetical protein	-
R4709_RS07215	-	1394878..1395177 (+)	300	WP_001013974.1	DUF4651 domain-containing protein	-
R4709_RS07220	-	1395174..1395491 (+)	318	WP_000615767.1	thioredoxin family protein	-
R4709_RS07225	ytpR	1395507..1396133 (+)	627	WP_000578309.1	YtpR family tRNA-binding protein	-
R4709_RS07230	-	1396166..1396927 (+)	762	WP_050115111.1	SDR family NAD(P)-dependent oxidoreductase	-
R4709_RS07235	ssbB/cilA	1397005..1397400 (+)	396	WP_000282442.1	single-stranded DNA-binding protein	Machinery gene
R4709_RS07240	groES	1397670..1397954 (+)	285	WP_000917330.1	co-chaperone GroES	-
R4709_RS07245	groL	1397970..1399592 (+)	1623	WP_000031585.1	chaperonin GroEL	-
R4709_RS11060	-	1399691..1401178 (-)	1488	WP_404968904.1	ISL3 family transposase	-
R4709_RS07260	-	1401263..1401544 (+)	282	WP_078839683.1	hypothetical protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14907.85 Da Isoelectric Point: 5.9409

                                >NTDB_id=895277 R4709_RS07235 WP_000282442.1 1397005..1397400(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16H3071-2]

MYNKVILIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=895277 R4709_RS07235 WP_000282442.1 1397005..1397400(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16H3071-2]

ATGTATAATAAAGTTATCTTGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTGAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT

GGGGCAGGCTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT

CGCTTTGAGAAAAATGGTCAGATGAACTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTAGAAAGTCGTGCTCA

ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae TIGR4	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae D39	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae R6	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	99.237	100	0.992
ssbB/cilA	Streptococcus mitis NCTC 12261	97.71	100	0.977
ssbA	Streptococcus mutans UA159	75.573	100	0.756
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.992	100	0.71
ssbB	Lactococcus lactis subsp. cremoris KW2	60.714	85.496	0.519
ssbA	Bacillus subtilis subsp. subtilis str. 168	51.887	80.916	0.42
ssb	Latilactobacillus sakei subsp. sakei 23K	47.788	86.26	0.412
ssbB	Bacillus subtilis subsp. subtilis str. 168	44.444	82.443	0.366

Detailed information NTG0895277