Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RVY75_RS10790 | Genome accession | NZ_CP136381 |
| Coordinates | 2102585..2102923 (+) | Length | 112 a.a. |
| NCBI ID | WP_002012564.1 | Uniprot ID | J8I4L2 |
| Organism | Bacillus mycoides strain PAMC 29501 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2052837..2106435 | 2102585..2102923 | within | 0 |
Gene organization within MGE regions
Location: 2052837..2106435
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RVY75_RS10530 (RVY75_10530) | essA | 2053915..2054418 (+) | 504 | WP_002165921.1 | type VII secretion protein EssA | - |
| RVY75_RS10535 (RVY75_10535) | - | 2054423..2054674 (+) | 252 | WP_001007571.1 | EsaB/YukD family protein | - |
| RVY75_RS10540 (RVY75_10540) | essB | 2054747..2055946 (+) | 1200 | WP_002012535.1 | type VII secretion protein EssB | - |
| RVY75_RS10545 (RVY75_10545) | essC | 2055990..2060495 (+) | 4506 | WP_316280869.1 | type VII secretion protein EssC | - |
| RVY75_RS10550 (RVY75_10550) | - | 2060492..2061295 (+) | 804 | WP_002165920.1 | DUF3952 domain-containing protein | - |
| RVY75_RS10555 (RVY75_10555) | - | 2061320..2062795 (+) | 1476 | WP_002012530.1 | hypothetical protein | - |
| RVY75_RS10560 (RVY75_10560) | - | 2062822..2063082 (+) | 261 | WP_002165918.1 | hypothetical protein | - |
| RVY75_RS10565 (RVY75_10565) | - | 2063084..2063401 (+) | 318 | WP_002012528.1 | DUF4176 domain-containing protein | - |
| RVY75_RS10570 (RVY75_10570) | - | 2063702..2063979 (+) | 278 | Protein_1995 | hypothetical protein | - |
| RVY75_RS10575 (RVY75_10575) | - | 2064071..2064865 (+) | 795 | WP_002012527.1 | hypothetical protein | - |
| RVY75_RS10580 (RVY75_10580) | - | 2065065..2065877 (+) | 813 | WP_002012526.1 | DUF3952 domain-containing protein | - |
| RVY75_RS10585 (RVY75_10585) | - | 2065912..2066709 (+) | 798 | WP_002012525.1 | DUF3952 domain-containing protein | - |
| RVY75_RS10590 (RVY75_10590) | - | 2067060..2067845 (-) | 786 | WP_002012524.1 | GNAT family N-acetyltransferase | - |
| RVY75_RS10595 (RVY75_10595) | ytfJ | 2067977..2068402 (+) | 426 | WP_002012522.1 | GerW family sporulation protein | - |
| RVY75_RS10600 (RVY75_10600) | - | 2068563..2069339 (+) | 777 | WP_002085994.1 | hypothetical protein | - |
| RVY75_RS10605 (RVY75_10605) | - | 2069391..2069711 (+) | 321 | WP_002165916.1 | hypothetical protein | - |
| RVY75_RS10610 (RVY75_10610) | - | 2069781..2069993 (+) | 213 | WP_002012518.1 | hypothetical protein | - |
| RVY75_RS10615 (RVY75_10615) | - | 2070023..2070361 (-) | 339 | WP_001253195.1 | hypothetical protein | - |
| RVY75_RS10620 (RVY75_10620) | - | 2070721..2071401 (+) | 681 | WP_002085991.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| RVY75_RS10625 (RVY75_10625) | - | 2071495..2073183 (+) | 1689 | WP_002031556.1 | formate--tetrahydrofolate ligase | - |
| RVY75_RS10630 (RVY75_10630) | - | 2073274..2073801 (+) | 528 | WP_002012514.1 | hypothetical protein | - |
| RVY75_RS10635 (RVY75_10635) | - | 2073821..2074990 (+) | 1170 | WP_002012513.1 | DEAD/DEAH box helicase | - |
| RVY75_RS10640 (RVY75_10640) | - | 2075005..2075085 (+) | 81 | Protein_2009 | VOC family protein | - |
| RVY75_RS10645 (RVY75_10645) | - | 2075130..2075768 (-) | 639 | WP_002135913.1 | zinc dependent phospholipase C family protein | - |
| RVY75_RS10650 (RVY75_10650) | - | 2075798..2076784 (-) | 987 | WP_002165915.1 | quinone oxidoreductase | - |
| RVY75_RS10655 (RVY75_10655) | - | 2076991..2077569 (+) | 579 | WP_002165914.1 | sigma-70 family RNA polymerase sigma factor | - |
| RVY75_RS10660 (RVY75_10660) | - | 2077566..2078246 (+) | 681 | WP_002165913.1 | DUF3600 domain-containing protein | - |
| RVY75_RS10665 (RVY75_10665) | - | 2078301..2078543 (-) | 243 | WP_002165912.1 | hypothetical protein | - |
| RVY75_RS10670 (RVY75_10670) | - | 2078855..2079289 (-) | 435 | WP_002012503.1 | hypothetical protein | - |
| RVY75_RS10675 (RVY75_10675) | - | 2079376..2080347 (-) | 972 | WP_002165911.1 | MBL fold metallo-hydrolase | - |
| RVY75_RS10680 (RVY75_10680) | - | 2080444..2080653 (-) | 210 | WP_002127081.1 | DUF3925 family protein | - |
| RVY75_RS10685 (RVY75_10685) | bsaA | 2080879..2081364 (+) | 486 | WP_002012499.1 | glutathione peroxidase | - |
| RVY75_RS10690 (RVY75_10690) | - | 2081444..2083672 (-) | 2229 | WP_002165910.1 | transglutaminaseTgpA domain-containing protein | - |
| RVY75_RS10695 (RVY75_10695) | - | 2083669..2084883 (-) | 1215 | WP_002012497.1 | DUF58 domain-containing protein | - |
| RVY75_RS10700 (RVY75_10700) | - | 2084883..2085845 (-) | 963 | WP_002165909.1 | MoxR family ATPase | - |
| RVY75_RS10705 (RVY75_10705) | ric | 2086278..2086985 (-) | 708 | WP_002012495.1 | iron-sulfur cluster repair di-iron protein | - |
| RVY75_RS10710 (RVY75_10710) | - | 2087190..2088185 (-) | 996 | WP_033715747.1 | excalibur calcium-binding domain-containing protein | - |
| RVY75_RS10715 (RVY75_10715) | exsG | 2088398..2088550 (+) | 153 | WP_002165907.1 | exosporium protein ExsG | - |
| RVY75_RS10720 (RVY75_10720) | - | 2088800..2089009 (+) | 210 | WP_002085943.1 | hypothetical protein | - |
| RVY75_RS10725 (RVY75_10725) | - | 2089273..2090883 (+) | 1611 | WP_002165906.1 | hypothetical protein | - |
| RVY75_RS10730 (RVY75_10730) | - | 2091078..2091662 (-) | 585 | WP_002165905.1 | hypothetical protein | - |
| RVY75_RS10735 (RVY75_10735) | - | 2092194..2092469 (+) | 276 | WP_002035358.1 | stage V sporulation protein S | - |
| RVY75_RS10740 (RVY75_10740) | - | 2092830..2093686 (-) | 857 | Protein_2029 | tyrosine-type recombinase/integrase | - |
| RVY75_RS10745 (RVY75_10745) | - | 2093760..2094060 (+) | 301 | Protein_2030 | transposase | - |
| RVY75_RS10750 (RVY75_10750) | - | 2094069..2094950 (+) | 882 | WP_002012550.1 | IS3 family transposase | - |
| RVY75_RS10755 (RVY75_10755) | - | 2095069..2096034 (-) | 966 | WP_286119619.1 | collagen-like protein | - |
| RVY75_RS10760 (RVY75_10760) | - | 2096957..2097559 (+) | 603 | WP_002012554.1 | DUF6944 family repetitive protein | - |
| RVY75_RS10765 (RVY75_10765) | - | 2097941..2098618 (-) | 678 | WP_002012555.1 | hypothetical protein | - |
| RVY75_RS10770 (RVY75_10770) | - | 2098728..2099375 (+) | 648 | WP_002012557.1 | HD domain-containing protein | - |
| RVY75_RS10775 (RVY75_10775) | - | 2099372..2101267 (+) | 1896 | WP_002127139.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| RVY75_RS10780 (RVY75_10780) | - | 2101343..2102074 (+) | 732 | WP_002165902.1 | Bax inhibitor-1/YccA family protein | - |
| RVY75_RS10785 (RVY75_10785) | - | 2102169..2102423 (+) | 255 | WP_002012563.1 | DUF4318 domain-containing protein | - |
| RVY75_RS10790 (RVY75_10790) | ssbA | 2102585..2102923 (+) | 339 | WP_002012564.1 | single-stranded DNA-binding protein | Machinery gene |
| RVY75_RS10795 (RVY75_10795) | - | 2103079..2104206 (+) | 1128 | WP_002012566.1 | conserved virulence factor C family protein | - |
| RVY75_RS10800 (RVY75_10800) | - | 2104210..2104593 (+) | 384 | WP_002012567.1 | thiol-disulfide oxidoreductase DCC family protein | - |
| RVY75_RS10805 (RVY75_10805) | - | 2104676..2105110 (+) | 435 | WP_002012568.1 | BrxA/BrxB family bacilliredoxin | - |
| RVY75_RS10810 (RVY75_10810) | - | 2105160..2105936 (+) | 777 | WP_002012570.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 112 a.a. Molecular weight: 12966.75 Da Isoelectric Point: 9.1002
>NTDB_id=890450 RVY75_RS10790 WP_002012564.1 2102585..2102923(+) (ssbA) [Bacillus mycoides strain PAMC 29501]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTS
NYDDEQGKRVYRTEVLIENITFLERRRESASQ
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTS
NYDDEQGKRVYRTEVLIENITFLERRRESASQ
Nucleotide
Download Length: 339 bp
>NTDB_id=890450 RVY75_RS10790 WP_002012564.1 2102585..2102923(+) (ssbA) [Bacillus mycoides strain PAMC 29501]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTTGTAT
GGAGAAGGTCGGCTGAAAATGTAACAGAATATTGTACGAAAGGCTCACTTGTTGGGATTACAGGACGTATTCATACGAGT
AATTACGATGATGAACAAGGAAAGAGAGTATATAGAACTGAAGTTCTGATTGAGAATATTACATTTTTAGAGAGAAGGCG
GGAGAGTGCATCGCAATAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTTGTAT
GGAGAAGGTCGGCTGAAAATGTAACAGAATATTGTACGAAAGGCTCACTTGTTGGGATTACAGGACGTATTCATACGAGT
AATTACGATGATGAACAAGGAAAGAGAGTATATAGAACTGAAGTTCTGATTGAGAATATTACATTTTTAGAGAGAAGGCG
GGAGAGTGCATCGCAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
94.643 |
0.545 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.774 |
94.643 |
0.509 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
50.442 |
100 |
0.509 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
43.86 |
100 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.909 |
98.214 |
0.402 |
| ssbA | Streptococcus mutans UA159 |
40.909 |
98.214 |
0.402 |