Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | RX143_RS08520 | Genome accession | NZ_CP136360 |
| Coordinates | 1733451..1733726 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain ES-3222 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1693046..1751831 | 1733451..1733726 | within | 0 |
Gene organization within MGE regions
Location: 1693046..1751831
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RX143_RS08225 (RX143_08225) | - | 1693046..1694053 (-) | 1008 | WP_010819472.1 | class I SAM-dependent methyltransferase | - |
| RX143_RS08230 (RX143_08230) | comGG | 1694182..1694535 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| RX143_RS08235 (RX143_08235) | comGF | 1694535..1694969 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| RX143_RS08240 (RX143_08240) | - | 1694959..1695330 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| RX143_RS08245 (RX143_08245) | - | 1695663..1695788 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| RX143_RS08250 (RX143_08250) | hemH | 1696085..1697026 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| RX143_RS08260 (RX143_08260) | - | 1697766..1698014 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| RX143_RS08265 (RX143_08265) | - | 1698086..1698286 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| RX143_RS08270 (RX143_08270) | - | 1699123..1700364 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| RX143_RS08275 (RX143_08275) | - | 1700365..1700598 (-) | 234 | WP_002384371.1 | phage holin | - |
| RX143_RS08280 (RX143_08280) | - | 1700591..1700812 (-) | 222 | WP_316497558.1 | hypothetical protein | - |
| RX143_RS08285 (RX143_08285) | - | 1700847..1701002 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| RX143_RS08290 (RX143_08290) | - | 1701004..1701324 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| RX143_RS08295 (RX143_08295) | - | 1701338..1701829 (-) | 492 | WP_010819473.1 | hypothetical protein | - |
| RX143_RS08300 (RX143_08300) | - | 1701829..1702116 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| RX143_RS08305 (RX143_08305) | - | 1702113..1702709 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| RX143_RS08310 (RX143_08310) | - | 1702702..1703583 (-) | 882 | WP_010819474.1 | phage baseplate upper protein | - |
| RX143_RS08315 (RX143_08315) | - | 1703602..1706409 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| RX143_RS08320 (RX143_08320) | - | 1706391..1707125 (-) | 735 | WP_002403868.1 | tail protein | - |
| RX143_RS08325 (RX143_08325) | - | 1707115..1710012 (-) | 2898 | WP_025189864.1 | tape measure protein | - |
| RX143_RS08330 (RX143_08330) | gpG | 1710260..1710610 (-) | 351 | WP_010819476.1 | phage tail assembly chaperone G | - |
| RX143_RS08335 (RX143_08335) | - | 1710663..1711511 (-) | 849 | WP_010819477.1 | major tail protein | - |
| RX143_RS08340 (RX143_08340) | - | 1711512..1711886 (-) | 375 | WP_010716865.1 | DUF6838 family protein | - |
| RX143_RS08345 (RX143_08345) | - | 1711889..1712287 (-) | 399 | WP_316497559.1 | HK97 gp10 family phage protein | - |
| RX143_RS08350 (RX143_08350) | - | 1712280..1712648 (-) | 369 | WP_010707371.1 | hypothetical protein | - |
| RX143_RS08355 (RX143_08355) | - | 1712645..1712989 (-) | 345 | WP_010819479.1 | hypothetical protein | - |
| RX143_RS08360 (RX143_08360) | - | 1713003..1713185 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| RX143_RS08365 (RX143_08365) | - | 1713214..1714101 (-) | 888 | WP_010819480.1 | DUF5309 domain-containing protein | - |
| RX143_RS08370 (RX143_08370) | - | 1714115..1714738 (-) | 624 | WP_010707369.1 | DUF4355 domain-containing protein | - |
| RX143_RS08375 (RX143_08375) | - | 1714879..1715142 (-) | 264 | WP_025189865.1 | DUF6275 family protein | - |
| RX143_RS08380 (RX143_08380) | - | 1715210..1715530 (-) | 321 | WP_002414520.1 | hypothetical protein | - |
| RX143_RS08385 (RX143_08385) | - | 1715587..1715817 (-) | 231 | WP_010819482.1 | hypothetical protein | - |
| RX143_RS08390 (RX143_08390) | - | 1715818..1717719 (-) | 1902 | WP_010819483.1 | phage minor head protein | - |
| RX143_RS08395 (RX143_08395) | - | 1717700..1719166 (-) | 1467 | WP_010819484.1 | phage portal protein | - |
| RX143_RS08400 (RX143_08400) | terL | 1719179..1720567 (-) | 1389 | WP_201763236.1 | phage terminase large subunit | - |
| RX143_RS08405 (RX143_08405) | - | 1720560..1721021 (-) | 462 | WP_010819486.1 | helix-turn-helix domain-containing protein | - |
| RX143_RS08410 (RX143_08410) | - | 1721052..1721282 (-) | 231 | WP_010819487.1 | hypothetical protein | - |
| RX143_RS08420 (RX143_08420) | - | 1722272..1722688 (-) | 417 | WP_002403876.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| RX143_RS08425 (RX143_08425) | - | 1723595..1724029 (-) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RX143_RS08430 (RX143_08430) | - | 1724038..1724337 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| RX143_RS08435 (RX143_08435) | - | 1724338..1724640 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| RX143_RS08440 (RX143_08440) | - | 1724637..1725509 (-) | 873 | WP_010715319.1 | helix-turn-helix domain-containing protein | - |
| RX143_RS08445 (RX143_08445) | - | 1725509..1725709 (-) | 201 | WP_010715320.1 | hypothetical protein | - |
| RX143_RS08450 (RX143_08450) | - | 1725714..1726355 (-) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| RX143_RS08455 (RX143_08455) | - | 1726360..1727094 (-) | 735 | WP_002402486.1 | ERF family protein | - |
| RX143_RS08460 (RX143_08460) | - | 1727087..1727404 (-) | 318 | WP_002402485.1 | hypothetical protein | - |
| RX143_RS08465 (RX143_08465) | - | 1727600..1727938 (-) | 339 | WP_010819488.1 | hypothetical protein | - |
| RX143_RS08470 (RX143_08470) | - | 1727975..1728184 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| RX143_RS08475 (RX143_08475) | - | 1728239..1728427 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| RX143_RS08480 (RX143_08480) | - | 1728453..1729175 (-) | 723 | WP_002410531.1 | Rha family transcriptional regulator | - |
| RX143_RS08485 (RX143_08485) | - | 1729198..1729509 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| RX143_RS08490 (RX143_08490) | - | 1729521..1729712 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| RX143_RS08495 (RX143_08495) | - | 1730008..1730349 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| RX143_RS08500 (RX143_08500) | - | 1730354..1731004 (+) | 651 | WP_025189866.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RX143_RS08505 (RX143_08505) | - | 1731100..1731729 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| RX143_RS08510 (RX143_08510) | - | 1731835..1732983 (+) | 1149 | WP_010819490.1 | site-specific integrase | - |
| RX143_RS08515 (RX143_08515) | comGD | 1733020..1733454 (-) | 435 | Protein_1646 | competence type IV pilus minor pilin ComGD | - |
| RX143_RS08520 (RX143_08520) | comGC/cglC | 1733451..1733726 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| RX143_RS08525 (RX143_08525) | comGB | 1733726..1734772 (-) | 1047 | WP_010819492.1 | competence type IV pilus assembly protein ComGB | - |
| RX143_RS08530 (RX143_08530) | comGA | 1734729..1735697 (-) | 969 | WP_010819493.1 | competence type IV pilus ATPase ComGA | - |
| RX143_RS08535 (RX143_08535) | - | 1735937..1737265 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| RX143_RS08540 (RX143_08540) | rlmN | 1737555..1738628 (-) | 1074 | WP_002381713.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| RX143_RS08545 (RX143_08545) | - | 1738753..1740582 (-) | 1830 | WP_010819494.1 | ABC transporter permease | - |
| RX143_RS08550 (RX143_08550) | - | 1740572..1741321 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| RX143_RS08555 (RX143_08555) | - | 1741439..1742140 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| RX143_RS08560 (RX143_08560) | - | 1742271..1744694 (-) | 2424 | WP_010819495.1 | DNA translocase FtsK | - |
| RX143_RS08565 (RX143_08565) | - | 1745008..1746219 (-) | 1212 | WP_010819496.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| RX143_RS08570 (RX143_08570) | - | 1746248..1747153 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| RX143_RS08575 (RX143_08575) | - | 1747275..1748255 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| RX143_RS08580 (RX143_08580) | cydC | 1748335..1750101 (-) | 1767 | WP_025189868.1 | thiol reductant ABC exporter subunit CydC | - |
| RX143_RS08585 (RX143_08585) | cydD | 1750098..1751831 (-) | 1734 | WP_010819498.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=890324 RX143_RS08520 WP_002356991.1 1733451..1733726(-) (comGC/cglC) [Enterococcus faecalis strain ES-3222]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=890324 RX143_RS08520 WP_002356991.1 1733451..1733726(-) (comGC/cglC) [Enterococcus faecalis strain ES-3222]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |