Detailed information NTG0884628

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: RPB93_RS16385
• Genome accession: NZ_CP135060
• Coordinates: 3233924..3234259 (-)
• Length: 111 a.a.
• NCBI ID: WP_000982013.1
• Uniprot ID: A0A9X6LR10
• Organism: Bacillus cereus strain B126_1
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	3233924..3244322	3233924..3234259	within	0

Gene organization within MGE regions

Location: 3233924..3244322

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RPB93_RS16385 (RPB93_16385)	ssbA	3233924..3234259 (-)	336	WP_000982013.1	single-stranded DNA-binding protein	Machinery gene
RPB93_RS16390 (RPB93_16390)	-	3234421..3234675 (-)	255	WP_000975133.1	DUF4318 domain-containing protein	-
RPB93_RS16395 (RPB93_16395)	-	3234781..3235512 (-)	732	WP_001260655.1	Bax inhibitor-1/YccA family protein	-
RPB93_RS16400 (RPB93_16400)	-	3235588..3237483 (-)	1896	WP_000783191.1	ABC-F family ATP-binding cassette domain-containing protein	-
RPB93_RS16405 (RPB93_16405)	-	3237480..3238127 (-)	648	WP_048536256.1	HD domain-containing protein	-
RPB93_RS16410 (RPB93_16410)	-	3238237..3239064 (+)	828	WP_070757438.1	hypothetical protein	-
RPB93_RS16415 (RPB93_16415)	-	3239498..3239713 (-)	216	WP_000756629.1	hypothetical protein	-
RPB93_RS16420 (RPB93_16420)	-	3239710..3240810 (-)	1101	WP_000584829.1	aspartate phosphatase	-
RPB93_RS16425 (RPB93_16425)	-	3241165..3241818 (+)	654	WP_000724008.1	hypothetical protein	-
RPB93_RS16430 (RPB93_16430)	-	3241888..3242103 (+)	216	WP_033665752.1	hypothetical protein	-
RPB93_RS16435 (RPB93_16435)	-	3242291..3242599 (+)	309	WP_000516502.1	helix-turn-helix domain-containing protein	-
RPB93_RS16440 (RPB93_16440)	-	3242554..3243462 (+)	909	WP_231130557.1	IS3 family transposase	-

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12785.64 Da
• Isoelectric Point: 9.4344

>NTDB_id=884628 RPB93_RS16385 WP_000982013.1 3233924..3234259(-) (ssbA) [Bacillus cereus strain B126_1]
MMNRVVLIGRLTKEPELYYTKQGVAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=884628 RPB93_RS16385 WP_000982013.1 3233924..3234259(-) (ssbA) [Bacillus cereus strain B126_1]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTTGCTTATGC
AAGAATATGTATTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGAAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGATCACTTGTTGGGATTACAGGGCGTATTCAGACGAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.491	95.495	0.559
ssb	Latilactobacillus sakei subsp. sakei 23K	55.66	95.495	0.532
ssbB	Bacillus subtilis subsp. subtilis str. 168	50.893	100	0.514
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	94.595	0.432
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbB/cilA	Streptococcus mitis NCTC 12261	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae Rx1	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae D39	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae R6	40	99.099	0.396
ssbB/cilA	Streptococcus mitis SK321	40	99.099	0.396
ssbA	Streptococcus mutans UA159	40	99.099	0.396