Detailed information NTG0883938

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: M9H33_RS06230
• Genome accession: NZ_CP134828
• Coordinates: 1293919..1294230 (+)
• Length: 103 a.a.
• NCBI ID: WP_029625707.1
• Uniprot ID: -
• Organism: Staphylococcus capitis strain ADJWO
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1288919..1299230

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
M9H33_RS06200 (M9H33_06200)	-	1289694..1289897 (+)	204	WP_002433937.1	YqgQ family protein	-
M9H33_RS06205 (M9H33_06205)	-	1289894..1290880 (+)	987	WP_023350198.1	ROK family glucokinase	-
M9H33_RS06210 (M9H33_06210)	-	1290880..1291206 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
M9H33_RS06215 (M9H33_06215)	-	1291206..1291829 (+)	624	WP_049399400.1	MBL fold metallo-hydrolase	-
M9H33_RS06220 (M9H33_06220)	comGA	1291887..1292861 (+)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
M9H33_RS06225 (M9H33_06225)	comGB	1292833..1293900 (+)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
M9H33_RS06230 (M9H33_06230)	comGC	1293919..1294230 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
M9H33_RS06235 (M9H33_06235)	comGD	1294208..1294657 (+)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
M9H33_RS06240 (M9H33_06240)	-	1294644..1294943 (+)	300	WP_023350203.1	hypothetical protein	-
M9H33_RS06245 (M9H33_06245)	comGF	1294861..1295352 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
M9H33_RS06250 (M9H33_06250)	-	1295522..1296031 (+)	510	WP_029625706.1	shikimate kinase	-
M9H33_RS06255 (M9H33_06255)	gcvT	1296240..1297331 (+)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
M9H33_RS06260 (M9H33_06260)	gcvPA	1297350..1298696 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=883938 M9H33_RS06230 WP_029625707.1 1293919..1294230(+) (comGC) [Staphylococcus capitis strain ADJWO]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=883938 M9H33_RS06230 WP_029625707.1 1293919..1294230(+) (comGC) [Staphylococcus capitis strain ADJWO]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369