Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | RNU01_RS06285 | Genome accession | NZ_CP134801 |
| Coordinates | 1198742..1199053 (+) | Length | 103 a.a. |
| NCBI ID | WP_311904906.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA73_2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1193742..1204053
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RNU01_RS06255 | - | 1194525..1194728 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| RNU01_RS06260 | - | 1194725..1195711 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| RNU01_RS06265 | - | 1195711..1196040 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| RNU01_RS06270 | - | 1196037..1196660 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| RNU01_RS06275 | comGA | 1196712..1197686 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| RNU01_RS06280 | comGB | 1197658..1198728 (+) | 1071 | WP_311904905.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| RNU01_RS06285 | comGC | 1198742..1199053 (+) | 312 | WP_311904906.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| RNU01_RS06290 | comGD | 1199031..1199477 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| RNU01_RS06295 | comGE | 1199464..1199763 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| RNU01_RS06300 | comGF | 1199681..1200178 (+) | 498 | WP_029642894.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| RNU01_RS06305 | - | 1200275..1200421 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| RNU01_RS06310 | - | 1200411..1200935 (+) | 525 | WP_001015119.1 | shikimate kinase | - |
| RNU01_RS06315 | gcvT | 1201094..1202185 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RNU01_RS06320 | gcvPA | 1202205..1203551 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11331.36 Da Isoelectric Point: 8.5268
>NTDB_id=883773 RNU01_RS06285 WP_311904906.1 1198742..1199053(+) (comGC) [Staphylococcus aureus strain SA73_2]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIESYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIESYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=883773 RNU01_RS06285 WP_311904906.1 1198742..1199053(+) (comGC) [Staphylococcus aureus strain SA73_2]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAATCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAATCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |