Detailed information NTG0882442

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: RL452_RS07500
• Genome accession: NZ_CP134620
• Coordinates: 1544404..1544715 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain Sa9
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1539404..1549715

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RL452_RS07465 (RL452_07455)	gcvPA	1539906..1541252 (-)	1347	WP_000019695.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
RL452_RS07470 (RL452_07460)	gcvT	1541272..1542363 (-)	1092	WP_000093341.1	glycine cleavage system aminomethyltransferase GcvT	-
RL452_RS07475 (RL452_07465)	-	1542522..1543046 (-)	525	WP_001015120.1	shikimate kinase	-
RL452_RS07480 (RL452_07470)	-	1543036..1543182 (-)	147	WP_078062659.1	hypothetical protein	-
RL452_RS07485 (RL452_07475)	comGF	1543279..1543776 (-)	498	WP_052658450.1	competence type IV pilus minor pilin ComGF	Machinery gene
RL452_RS07490 (RL452_07480)	comGE	1543694..1543993 (-)	300	WP_045157654.1	hypothetical protein	Machinery gene
RL452_RS07495 (RL452_07485)	comGD	1543980..1544426 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
RL452_RS07500 (RL452_07490)	comGC	1544404..1544715 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
RL452_RS07505 (RL452_07495)	comGB	1544729..1545799 (-)	1071	Protein_1469	competence type IV pilus assembly protein ComGB	-
RL452_RS07510 (RL452_07500)	comGA	1545771..1546745 (-)	975	WP_000697229.1	competence type IV pilus ATPase ComGA	Machinery gene
RL452_RS07515 (RL452_07505)	-	1546797..1547420 (-)	624	WP_338595134.1	MBL fold metallo-hydrolase	-
RL452_RS07520 (RL452_07510)	-	1547417..1547746 (-)	330	WP_001018873.1	MTH1187 family thiamine-binding protein	-
RL452_RS07525 (RL452_07515)	-	1547746..1548732 (-)	987	WP_000161315.1	ROK family glucokinase	-
RL452_RS07530 (RL452_07520)	-	1548729..1548932 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=882442 RL452_RS07500 WP_000472256.1 1544404..1544715(-) (comGC) [Staphylococcus aureus strain Sa9]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=882442 RL452_RS07500 WP_000472256.1 1544404..1544715(-) (comGC) [Staphylococcus aureus strain Sa9]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369