Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RIM74_RS09680 | Genome accession | NZ_CP133955 |
| Coordinates | 2038514..2038909 (-) | Length | 131 a.a. |
| NCBI ID | WP_012678670.1 | Uniprot ID | A0A7Z9D3W7 |
| Organism | Streptococcus equi subsp. equi strain HTP133 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2023934..2059942 | 2038514..2038909 | within | 0 |
Gene organization within MGE regions
Location: 2023934..2059942
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM74_RS09620 (RIM74_09620) | groES | 2025480..2025767 (+) | 288 | WP_012514806.1 | co-chaperone GroES | - |
| RIM74_RS09625 (RIM74_09625) | groL | 2025835..2027460 (+) | 1626 | WP_012678897.1 | chaperonin GroEL | - |
| RIM74_RS09630 (RIM74_09630) | - | 2027614..2028956 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| RIM74_RS09635 (RIM74_09635) | - | 2028990..2030165 (+) | 1176 | WP_317582852.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| RIM74_RS09640 (RIM74_09640) | hslO | 2030415..2031287 (+) | 873 | WP_317582853.1 | Hsp33 family molecular chaperone HslO | - |
| RIM74_RS09645 (RIM74_09645) | dusB | 2031274..2032251 (+) | 978 | WP_015898643.1 | tRNA dihydrouridine synthase DusB | - |
| RIM74_RS09650 (RIM74_09650) | - | 2032272..2032913 (+) | 642 | Protein_1847 | deoxynucleoside kinase | - |
| RIM74_RS09655 (RIM74_09655) | - | 2033199..2034203 (+) | 1005 | WP_015898644.1 | hypothetical protein | - |
| RIM74_RS09660 (RIM74_09660) | - | 2034302..2035105 (-) | 804 | WP_015898645.1 | ABC transporter ATP-binding protein | - |
| RIM74_RS09665 (RIM74_09665) | - | 2035114..2035998 (-) | 885 | WP_015898646.1 | ABC transporter permease | - |
| RIM74_RS09670 (RIM74_09670) | - | 2036113..2037075 (-) | 963 | WP_317582854.1 | ABC transporter substrate-binding protein | - |
| RIM74_RS09675 (RIM74_09675) | - | 2037093..2038067 (-) | 975 | WP_015898648.1 | ABC transporter substrate-binding protein | - |
| RIM74_RS09680 (RIM74_09680) | ssbA | 2038514..2038909 (-) | 396 | WP_012678670.1 | single-stranded DNA-binding protein | Machinery gene |
| RIM74_RS09685 (RIM74_09685) | - | 2039021..2039734 (+) | 714 | WP_015898649.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| RIM74_RS09690 (RIM74_09690) | ytpR | 2040037..2040663 (-) | 627 | WP_015898650.1 | YtpR family tRNA-binding protein | - |
| RIM74_RS09695 (RIM74_09695) | - | 2040678..2040995 (-) | 318 | WP_015898651.1 | thioredoxin family protein | - |
| RIM74_RS09700 (RIM74_09700) | - | 2040992..2041276 (-) | 285 | WP_279526906.1 | DUF4651 domain-containing protein | - |
| RIM74_RS09705 (RIM74_09705) | pepA | 2041684..2042751 (+) | 1068 | WP_015898653.1 | glutamyl aminopeptidase | - |
| RIM74_RS09710 (RIM74_09710) | proC | 2042835..2043608 (+) | 774 | WP_015898654.1 | pyrroline-5-carboxylate reductase | - |
| RIM74_RS09715 (RIM74_09715) | - | 2043831..2044268 (-) | 438 | WP_015898655.1 | hypothetical protein | - |
| RIM74_RS09720 (RIM74_09720) | - | 2044298..2044972 (-) | 675 | WP_012678678.1 | CPBP family intramembrane glutamic endopeptidase | - |
| RIM74_RS09725 (RIM74_09725) | - | 2044982..2045434 (-) | 453 | WP_317582855.1 | DNA-binding protein | - |
| RIM74_RS09730 (RIM74_09730) | - | 2045436..2045639 (-) | 204 | WP_012516427.1 | helix-turn-helix transcriptional regulator | - |
| RIM74_RS09735 (RIM74_09735) | yaaA | 2046081..2046812 (+) | 732 | WP_015898656.1 | peroxide stress protein YaaA | - |
| RIM74_RS09740 (RIM74_09740) | nrdG | 2047270..2047884 (-) | 615 | WP_012678681.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| RIM74_RS09745 (RIM74_09745) | - | 2047894..2048388 (-) | 495 | WP_012516431.1 | GNAT family N-acetyltransferase | - |
| RIM74_RS09750 (RIM74_09750) | - | 2048401..2049336 (-) | 936 | WP_317582856.1 | Gfo/Idh/MocA family oxidoreductase | - |
| RIM74_RS09755 (RIM74_09755) | - | 2049364..2049510 (-) | 147 | WP_012516433.1 | hypothetical protein | - |
| RIM74_RS09760 (RIM74_09760) | nrdD | 2049616..2051814 (-) | 2199 | WP_015898658.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| RIM74_RS09765 (RIM74_09765) | - | 2051911..2053470 (-) | 1560 | WP_015898659.1 | membrane protein | - |
| RIM74_RS09770 (RIM74_09770) | - | 2054018..2054317 (-) | 300 | WP_012516437.1 | DUF1292 domain-containing protein | - |
| RIM74_RS09775 (RIM74_09775) | ruvX | 2054327..2054746 (-) | 420 | WP_015898660.1 | Holliday junction resolvase RuvX | - |
| RIM74_RS09780 (RIM74_09780) | - | 2054743..2055012 (-) | 270 | WP_012516439.1 | IreB family regulatory phosphoprotein | - |
| RIM74_RS09785 (RIM74_09785) | spx | 2055125..2055523 (-) | 399 | WP_012516440.1 | transcriptional regulator Spx | - |
| RIM74_RS09790 (RIM74_09790) | recA | 2055899..2057035 (-) | 1137 | WP_012678688.1 | recombinase RecA | Machinery gene |
| RIM74_RS09795 (RIM74_09795) | cinA | 2057129..2058400 (-) | 1272 | WP_015898661.1 | competence/damage-inducible protein A | Machinery gene |
| RIM74_RS09800 (RIM74_09800) | - | 2059086..2059376 (-) | 291 | WP_012516443.1 | hypothetical protein | - |
| RIM74_RS09805 (RIM74_09805) | - | 2059370..2059942 (-) | 573 | WP_015898662.1 | phospholipase A2 SlaB | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14768.92 Da Isoelectric Point: 8.9315
>NTDB_id=877884 RIM74_RS09680 WP_012678670.1 2038514..2038909(-) (ssbA) [Streptococcus equi subsp. equi strain HTP133]
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
Nucleotide
Download Length: 396 bp
>NTDB_id=877884 RIM74_RS09680 WP_012678670.1 2038514..2038909(-) (ssbA) [Streptococcus equi subsp. equi strain HTP133]
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
76.336 |
100 |
0.763 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
71.756 |
100 |
0.718 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
70.992 |
100 |
0.71 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis SK321 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
69.466 |
100 |
0.695 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.821 |
85.496 |
0.511 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
44.444 |
89.313 |
0.397 |