Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RCF72_RS08105 | Genome accession | NZ_CP133242 |
| Coordinates | 1670686..1671105 (-) | Length | 139 a.a. |
| NCBI ID | WP_037572052.1 | Uniprot ID | A0AAX0ZFD5 |
| Organism | Staphylococcus chromogenes strain BTM | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1635603..1680047 | 1670686..1671105 | within | 0 |
Gene organization within MGE regions
Location: 1635603..1680047
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RCF72_RS07895 (RCF72_07855) | - | 1635603..1636379 (-) | 777 | WP_103159402.1 | ABC transporter permease | - |
| RCF72_RS07900 (RCF72_07860) | - | 1636376..1637023 (-) | 648 | WP_105963371.1 | ABC transporter ATP-binding protein | - |
| RCF72_RS07905 (RCF72_07865) | - | 1637035..1637592 (-) | 558 | WP_037571946.1 | GNAT family N-acetyltransferase | - |
| RCF72_RS07910 (RCF72_07870) | - | 1638791..1639048 (-) | 258 | WP_241956305.1 | hypothetical protein | - |
| RCF72_RS07915 (RCF72_07875) | - | 1640333..1641778 (-) | 1446 | WP_105965208.1 | SH3 domain-containing protein | - |
| RCF72_RS07920 (RCF72_07880) | - | 1641759..1642193 (-) | 435 | WP_233666351.1 | phage holin | - |
| RCF72_RS07925 (RCF72_07885) | - | 1642205..1642600 (-) | 396 | WP_119562276.1 | hypothetical protein | - |
| RCF72_RS07930 (RCF72_07890) | - | 1642584..1643006 (-) | 423 | WP_119562274.1 | hypothetical protein | - |
| RCF72_RS07935 (RCF72_07895) | - | 1643182..1643466 (-) | 285 | WP_151367916.1 | hypothetical protein | - |
| RCF72_RS07940 (RCF72_07900) | - | 1643506..1643649 (-) | 144 | WP_165806168.1 | hypothetical protein | - |
| RCF72_RS07945 (RCF72_07905) | - | 1643633..1647547 (-) | 3915 | WP_419791973.1 | phage tail spike protein | - |
| RCF72_RS07950 (RCF72_07910) | - | 1647549..1649048 (-) | 1500 | WP_419791974.1 | phage distal tail protein | - |
| RCF72_RS07955 (RCF72_07915) | - | 1649048..1653625 (-) | 4578 | WP_419791975.1 | phage tail tape measure protein | - |
| RCF72_RS07960 (RCF72_07920) | gpG | 1653650..1654282 (-) | 633 | WP_419791976.1 | phage tail assembly chaperone G | - |
| RCF72_RS07965 (RCF72_07925) | - | 1654352..1655290 (-) | 939 | WP_419791977.1 | major tail protein | - |
| RCF72_RS07970 (RCF72_07930) | - | 1655302..1655664 (-) | 363 | WP_419791978.1 | DUF806 family protein | - |
| RCF72_RS07975 (RCF72_07935) | - | 1655661..1656038 (-) | 378 | WP_419791979.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RCF72_RS07980 (RCF72_07940) | - | 1656038..1656370 (-) | 333 | WP_419792350.1 | head-tail adaptor protein | - |
| RCF72_RS07985 (RCF72_07945) | - | 1656351..1656641 (-) | 291 | WP_105963556.1 | head-tail connector protein | - |
| RCF72_RS07990 (RCF72_07950) | - | 1656651..1656809 (-) | 159 | WP_164671795.1 | hypothetical protein | - |
| RCF72_RS07995 (RCF72_07955) | - | 1656822..1658072 (-) | 1251 | WP_419791980.1 | phage major capsid protein | - |
| RCF72_RS08000 (RCF72_07960) | - | 1658143..1658742 (-) | 600 | WP_419790608.1 | HK97 family phage prohead protease | - |
| RCF72_RS08005 (RCF72_07965) | - | 1658693..1659991 (-) | 1299 | WP_419791981.1 | phage portal protein | - |
| RCF72_RS08010 (RCF72_07970) | - | 1660208..1661911 (-) | 1704 | WP_419791982.1 | terminase large subunit | - |
| RCF72_RS08015 (RCF72_07975) | - | 1661911..1662381 (-) | 471 | WP_103158815.1 | phage terminase small subunit P27 family | - |
| RCF72_RS08020 (RCF72_07980) | - | 1662462..1662839 (-) | 378 | WP_419791983.1 | HNH endonuclease | - |
| RCF72_RS08025 (RCF72_07985) | - | 1662844..1663206 (-) | 363 | WP_107388668.1 | hypothetical protein | - |
| RCF72_RS08030 (RCF72_07990) | - | 1663434..1663862 (-) | 429 | WP_051604933.1 | hypothetical protein | - |
| RCF72_RS08035 (RCF72_07995) | - | 1663880..1664098 (-) | 219 | WP_037572018.1 | hypothetical protein | - |
| RCF72_RS08040 (RCF72_08000) | - | 1664160..1664582 (-) | 423 | WP_107370376.1 | hypothetical protein | - |
| RCF72_RS08045 (RCF72_08005) | - | 1664909..1665421 (-) | 513 | WP_105967188.1 | dUTP diphosphatase | - |
| RCF72_RS08050 (RCF72_08010) | - | 1665531..1665845 (+) | 315 | WP_037572025.1 | DUF4870 domain-containing protein | - |
| RCF72_RS08055 (RCF72_08015) | - | 1665873..1666085 (-) | 213 | WP_037572027.1 | hypothetical protein | - |
| RCF72_RS08060 (RCF72_08020) | - | 1666085..1666321 (-) | 237 | WP_037572029.1 | hypothetical protein | - |
| RCF72_RS08065 (RCF72_08025) | - | 1666321..1666539 (-) | 219 | Protein_1554 | DUF3310 domain-containing protein | - |
| RCF72_RS08070 (RCF72_08030) | - | 1666541..1666732 (-) | 192 | WP_037572034.1 | hypothetical protein | - |
| RCF72_RS08075 (RCF72_08035) | - | 1666733..1667149 (-) | 417 | WP_419791984.1 | hypothetical protein | - |
| RCF72_RS08080 (RCF72_08040) | - | 1667151..1667579 (-) | 429 | WP_037572039.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RCF72_RS08085 (RCF72_08050) | - | 1667743..1668528 (-) | 786 | WP_105963542.1 | ATP-binding protein | - |
| RCF72_RS08090 (RCF72_08055) | - | 1668529..1669257 (-) | 729 | WP_037572043.1 | conserved phage C-terminal domain-containing protein | - |
| RCF72_RS08095 (RCF72_08060) | - | 1669320..1669952 (+) | 633 | WP_037572046.1 | hypothetical protein | - |
| RCF72_RS08100 (RCF72_08065) | - | 1670006..1670674 (-) | 669 | WP_037572049.1 | putative HNHc nuclease | - |
| RCF72_RS08105 (RCF72_08070) | ssbA | 1670686..1671105 (-) | 420 | WP_037572052.1 | single-stranded DNA-binding protein | Machinery gene |
| RCF72_RS08110 (RCF72_08075) | - | 1671105..1671728 (-) | 624 | WP_037572055.1 | ERF family protein | - |
| RCF72_RS08115 (RCF72_08080) | - | 1671725..1671943 (-) | 219 | WP_037572058.1 | DUF2483 family protein | - |
| RCF72_RS08120 (RCF72_08085) | - | 1671940..1672209 (-) | 270 | WP_419791985.1 | hypothetical protein | - |
| RCF72_RS08125 (RCF72_08090) | - | 1672461..1672673 (-) | 213 | WP_037572065.1 | hypothetical protein | - |
| RCF72_RS08130 (RCF72_08095) | - | 1672941..1673201 (-) | 261 | WP_105965179.1 | hypothetical protein | - |
| RCF72_RS08135 (RCF72_08100) | - | 1673285..1673665 (+) | 381 | WP_105963625.1 | DUF2513 domain-containing protein | - |
| RCF72_RS08140 (RCF72_08105) | - | 1673652..1673849 (-) | 198 | WP_037572072.1 | hypothetical protein | - |
| RCF72_RS08145 (RCF72_08110) | - | 1673862..1674635 (-) | 774 | WP_107360653.1 | phage antirepressor KilAC domain-containing protein | - |
| RCF72_RS08150 (RCF72_08115) | - | 1674648..1674890 (-) | 243 | WP_233664344.1 | helix-turn-helix domain-containing protein | - |
| RCF72_RS08155 (RCF72_08120) | - | 1675065..1675397 (+) | 333 | WP_419791986.1 | helix-turn-helix domain-containing protein | - |
| RCF72_RS08160 (RCF72_08125) | - | 1675412..1675921 (+) | 510 | WP_107360855.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RCF72_RS08165 (RCF72_08130) | - | 1675890..1676867 (+) | 978 | WP_107360856.1 | thermonuclease family protein | - |
| RCF72_RS08170 (RCF72_08135) | - | 1676895..1677005 (+) | 111 | Protein_1575 | toxin | - |
| RCF72_RS08175 (RCF72_08140) | - | 1677405..1677581 (+) | 177 | WP_157946202.1 | hypothetical protein | - |
| RCF72_RS08180 (RCF72_08145) | - | 1677847..1678815 (+) | 969 | WP_037572091.1 | DUF3644 domain-containing protein | - |
| RCF72_RS08185 (RCF72_08150) | - | 1678998..1680047 (+) | 1050 | WP_419791987.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.35 Da Isoelectric Point: 4.9327
>NTDB_id=872726 RCF72_RS08105 WP_037572052.1 1670686..1671105(-) (ssbA) [Staphylococcus chromogenes strain BTM]
MLNRVVLVGRLTKDPEFRTTPSGVEVTTFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDNVQFLEPKNNGQSNSQPKQQQGQVQDNPFDNASIDDDDLPF
MLNRVVLVGRLTKDPEFRTTPSGVEVTTFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDNVQFLEPKNNGQSNSQPKQQQGQVQDNPFDNASIDDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=872726 RCF72_RS08105 WP_037572052.1 1670686..1671105(-) (ssbA) [Staphylococcus chromogenes strain BTM]
ATGCTTAACAGAGTTGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGGCGTAGAAGTAAC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAGTAAAGATGGAGAACAACAAGCTGACTTTATTAATTGCGTTGTAT
TCCGCAAGCAAGCTGAAAACGTCAAAAACTTTCTAAGTAAAGGTAGCTTAGCAGGTGTTGATGGACGTATGCAATCACGC
AGTTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTTGTTTGCGACAACGTACAATTTTTAGAACCTAAAAA
TAATGGTCAATCGAACAGTCAACCTAAACAACAACAAGGGCAAGTGCAAGATAATCCTTTTGATAACGCTAGTATCGATG
ACGACGATTTACCTTTCTAG
ATGCTTAACAGAGTTGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGGCGTAGAAGTAAC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAGTAAAGATGGAGAACAACAAGCTGACTTTATTAATTGCGTTGTAT
TCCGCAAGCAAGCTGAAAACGTCAAAAACTTTCTAAGTAAAGGTAGCTTAGCAGGTGTTGATGGACGTATGCAATCACGC
AGTTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTTGTTTGCGACAACGTACAATTTTTAGAACCTAAAAA
TAATGGTCAATCGAACAGTCAACCTAAACAACAACAAGGGCAAGTGCAAGATAATCCTTTTGATAACGCTAGTATCGATG
ACGACGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.676 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.612 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
76.259 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.781 |
100 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.395 |
100 |
0.388 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.129 |
100 |
0.381 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.41 |
100 |
0.374 |