Detailed information NTG0859190

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: Q3V60_RS07575
• Genome accession: NZ_CP130516
• Coordinates: 1571840..1572151 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA27-SX
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1566840..1577151

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q3V60_RS07540	gcvPA	1567342..1568688 (-)	1347	WP_077156047.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
Q3V60_RS07545	gcvT	1568708..1569799 (-)	1092	WP_000093345.1	glycine cleavage system aminomethyltransferase GcvT	-
Q3V60_RS07550	-	1569958..1570482 (-)	525	WP_001015121.1	shikimate kinase	-
Q3V60_RS07555	-	1570472..1570618 (-)	147	WP_001789879.1	hypothetical protein	-
Q3V60_RS07560	comGF	1570715..1571212 (-)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
Q3V60_RS07565	comGE	1571130..1571429 (-)	300	WP_000844410.1	hypothetical protein	Machinery gene
Q3V60_RS07570	comGD	1571416..1571862 (-)	447	WP_303062040.1	competence type IV pilus minor pilin ComGD	Machinery gene
Q3V60_RS07575	comGC	1571840..1572151 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
Q3V60_RS07580	comGB	1572165..1573235 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
Q3V60_RS07585	comGA	1573207..1574181 (-)	975	WP_000697219.1	competence type IV pilus ATPase ComGA	Machinery gene
Q3V60_RS07590	-	1574233..1574856 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
Q3V60_RS07595	-	1574853..1575182 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
Q3V60_RS07600	-	1575182..1576168 (-)	987	WP_000161315.1	ROK family glucokinase	-
Q3V60_RS07605	-	1576165..1576368 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=859190 Q3V60_RS07575 WP_000472256.1 1571840..1572151(-) (comGC) [Staphylococcus aureus strain SA27-SX]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=859190 Q3V60_RS07575 WP_000472256.1 1571840..1572151(-) (comGC) [Staphylococcus aureus strain SA27-SX]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369