Detailed information
Overview
| Name | comEC | Type | Machinery gene |
| Locus tag | Q0M94_RS03615 | Genome accession | NZ_CP129906 |
| Coordinates | 677432..677635 (+) | Length | 67 a.a. |
| NCBI ID | WP_407540499.1 | Uniprot ID | - |
| Organism | Deinococcus radiomollis strain PO-04-20-132 | ||
| Function | ssDNA transport through the inner membrane (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 631512..681815 | 677432..677635 | within | 0 |
Gene organization within MGE regions
Location: 631512..681815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q0M94_RS03320 (Q0M94_03320) | comEC | 631512..633575 (+) | 2064 | WP_407540441.1 | ComEC/Rec2 family competence protein | Machinery gene |
| Q0M94_RS03325 (Q0M94_03325) | - | 633777..634682 (-) | 906 | WP_407540442.1 | DUF3037 domain-containing protein | - |
| Q0M94_RS03330 (Q0M94_03330) | - | 634686..635540 (-) | 855 | WP_407540443.1 | HipA family kinase | - |
| Q0M94_RS03335 (Q0M94_03335) | - | 635941..636201 (+) | 261 | WP_407540444.1 | hypothetical protein | - |
| Q0M94_RS03340 (Q0M94_03340) | - | 636596..636958 (-) | 363 | WP_407540445.1 | hypothetical protein | - |
| Q0M94_RS03345 (Q0M94_03345) | - | 636955..637401 (-) | 447 | WP_407540446.1 | hypothetical protein | - |
| Q0M94_RS03350 (Q0M94_03350) | - | 637483..637803 (-) | 321 | WP_407540447.1 | DUF6527 family protein | - |
| Q0M94_RS03355 (Q0M94_03355) | - | 637883..638368 (-) | 486 | WP_407540448.1 | glycosyl hydrolase 108 family protein | - |
| Q0M94_RS03360 (Q0M94_03360) | - | 638365..638697 (-) | 333 | WP_407540449.1 | hypothetical protein | - |
| Q0M94_RS03365 (Q0M94_03365) | - | 638687..639115 (-) | 429 | WP_407540450.1 | hypothetical protein | - |
| Q0M94_RS03370 (Q0M94_03370) | - | 639112..639471 (-) | 360 | WP_407540451.1 | hypothetical protein | - |
| Q0M94_RS03375 (Q0M94_03375) | - | 639479..639946 (-) | 468 | WP_407540452.1 | hypothetical protein | - |
| Q0M94_RS03380 (Q0M94_03380) | - | 640005..643220 (-) | 3216 | WP_407540453.1 | hypothetical protein | - |
| Q0M94_RS03385 (Q0M94_03385) | - | 643217..643588 (-) | 372 | WP_407540454.1 | hypothetical protein | - |
| Q0M94_RS03390 (Q0M94_03390) | - | 643588..644859 (-) | 1272 | WP_407540455.1 | hypothetical protein | - |
| Q0M94_RS03395 (Q0M94_03395) | - | 644852..645589 (-) | 738 | WP_407540456.1 | hypothetical protein | - |
| Q0M94_RS03400 (Q0M94_03400) | - | 645586..646659 (-) | 1074 | WP_407540457.1 | baseplate J/gp47 family protein | - |
| Q0M94_RS03405 (Q0M94_03405) | - | 646649..647026 (-) | 378 | WP_407540458.1 | hypothetical protein | - |
| Q0M94_RS03410 (Q0M94_03410) | - | 647023..647517 (-) | 495 | WP_407540459.1 | hypothetical protein | - |
| Q0M94_RS03415 (Q0M94_03415) | - | 647514..648164 (-) | 651 | WP_407540460.1 | hypothetical protein | - |
| Q0M94_RS03420 (Q0M94_03420) | - | 648165..648713 (-) | 549 | WP_407540461.1 | hypothetical protein | - |
| Q0M94_RS03425 (Q0M94_03425) | - | 648710..651466 (-) | 2757 | WP_407540462.1 | hypothetical protein | - |
| Q0M94_RS03430 (Q0M94_03430) | - | 651538..651978 (-) | 441 | WP_407540463.1 | hypothetical protein | - |
| Q0M94_RS03435 (Q0M94_03435) | - | 652137..652460 (-) | 324 | WP_407540464.1 | hypothetical protein | - |
| Q0M94_RS03440 (Q0M94_03440) | - | 652497..652943 (-) | 447 | WP_407540465.1 | hypothetical protein | - |
| Q0M94_RS03445 (Q0M94_03445) | - | 652945..654366 (-) | 1422 | WP_407540466.1 | DUF2586 family protein | - |
| Q0M94_RS03450 (Q0M94_03450) | - | 654363..654599 (-) | 237 | WP_407540467.1 | hypothetical protein | - |
| Q0M94_RS03455 (Q0M94_03455) | - | 654609..655070 (-) | 462 | WP_407540468.1 | hypothetical protein | - |
| Q0M94_RS03460 (Q0M94_03460) | - | 655067..655561 (-) | 495 | WP_407540469.1 | phage virion morphogenesis protein | - |
| Q0M94_RS03465 (Q0M94_03465) | - | 655569..655970 (-) | 402 | WP_407540470.1 | phage protein Gp36 family protein | - |
| Q0M94_RS03470 (Q0M94_03470) | - | 655970..656326 (-) | 357 | WP_407540471.1 | hypothetical protein | - |
| Q0M94_RS03475 (Q0M94_03475) | - | 656326..657249 (-) | 924 | WP_407540472.1 | Mu-like prophage major head subunit gpT family protein | - |
| Q0M94_RS03480 (Q0M94_03480) | - | 657324..657746 (-) | 423 | WP_407540473.1 | hypothetical protein | - |
| Q0M94_RS03485 (Q0M94_03485) | - | 657750..658919 (-) | 1170 | WP_407540474.1 | phage protease | - |
| Q0M94_RS03490 (Q0M94_03490) | - | 658916..659593 (-) | 678 | WP_407540475.1 | phage minor head protein | - |
| Q0M94_RS03495 (Q0M94_03495) | - | 659593..661161 (-) | 1569 | WP_407540476.1 | DUF935 family protein | - |
| Q0M94_RS03500 (Q0M94_03500) | - | 661161..662501 (-) | 1341 | WP_407540477.1 | terminase | - |
| Q0M94_RS03505 (Q0M94_03505) | - | 662498..663211 (-) | 714 | WP_407540478.1 | terminase small subunit | - |
| Q0M94_RS03510 (Q0M94_03510) | - | 663238..663606 (+) | 369 | WP_407540479.1 | hypothetical protein | - |
| Q0M94_RS03515 (Q0M94_03515) | - | 663695..664201 (-) | 507 | WP_407540480.1 | hypothetical protein | - |
| Q0M94_RS03520 (Q0M94_03520) | - | 664231..664512 (-) | 282 | WP_407540481.1 | hypothetical protein | - |
| Q0M94_RS03525 (Q0M94_03525) | - | 664509..664967 (-) | 459 | WP_407540482.1 | hypothetical protein | - |
| Q0M94_RS03530 (Q0M94_03530) | - | 664964..665365 (-) | 402 | WP_407540483.1 | hypothetical protein | - |
| Q0M94_RS03535 (Q0M94_03535) | - | 665362..665697 (-) | 336 | WP_407540484.1 | hypothetical protein | - |
| Q0M94_RS03540 (Q0M94_03540) | - | 665694..666317 (-) | 624 | WP_407540485.1 | hypothetical protein | - |
| Q0M94_RS03545 (Q0M94_03545) | - | 666589..669009 (-) | 2421 | WP_407540486.1 | phage/plasmid primase, P4 family | - |
| Q0M94_RS03550 (Q0M94_03550) | - | 669124..669492 (+) | 369 | WP_407540487.1 | hypothetical protein | - |
| Q0M94_RS03555 (Q0M94_03555) | - | 669517..670077 (-) | 561 | WP_407540488.1 | hypothetical protein | - |
| Q0M94_RS03560 (Q0M94_03560) | - | 670074..672191 (-) | 2118 | WP_407540489.1 | AAA family ATPase | - |
| Q0M94_RS03565 (Q0M94_03565) | - | 672269..672979 (-) | 711 | WP_407540490.1 | hypothetical protein | - |
| Q0M94_RS03570 (Q0M94_03570) | - | 673091..673402 (-) | 312 | WP_407540491.1 | hypothetical protein | - |
| Q0M94_RS03575 (Q0M94_03575) | - | 673406..673639 (-) | 234 | WP_407540492.1 | hypothetical protein | - |
| Q0M94_RS03580 (Q0M94_03580) | - | 673639..674016 (-) | 378 | WP_407540493.1 | hypothetical protein | - |
| Q0M94_RS03585 (Q0M94_03585) | - | 674013..674213 (-) | 201 | WP_407540494.1 | hypothetical protein | - |
| Q0M94_RS03590 (Q0M94_03590) | - | 674276..674428 (-) | 153 | WP_407540495.1 | hypothetical protein | - |
| Q0M94_RS03595 (Q0M94_03595) | - | 674425..674673 (-) | 249 | WP_407540496.1 | helix-turn-helix transcriptional regulator | - |
| Q0M94_RS03600 (Q0M94_03600) | - | 674800..675513 (+) | 714 | WP_407541458.1 | helix-turn-helix domain-containing protein | - |
| Q0M94_RS03605 (Q0M94_03605) | - | 675620..676003 (+) | 384 | WP_407540497.1 | helix-turn-helix transcriptional regulator | - |
| Q0M94_RS03610 (Q0M94_03610) | - | 676003..677415 (+) | 1413 | WP_407540498.1 | recombinase family protein | - |
| Q0M94_RS03615 (Q0M94_03615) | comEC | 677432..677635 (+) | 204 | WP_407540499.1 | ComEC/Rec2 family competence protein | Machinery gene |
| Q0M94_RS03620 (Q0M94_03620) | - | 677645..678130 (+) | 486 | WP_407540500.1 | hypothetical protein | - |
| Q0M94_RS03625 (Q0M94_03625) | nrdR | 678536..678982 (-) | 447 | WP_407540501.1 | transcriptional regulator NrdR | - |
| Q0M94_RS03630 (Q0M94_03630) | - | 678989..679762 (-) | 774 | WP_407540502.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| Q0M94_RS03635 (Q0M94_03635) | - | 680006..680902 (+) | 897 | WP_407540503.1 | phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | - |
| Q0M94_RS03640 (Q0M94_03640) | phnC | 681069..681815 (+) | 747 | WP_407540504.1 | phosphonate ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 67 a.a. Molecular weight: 7482.48 Da Isoelectric Point: 11.3658
>NTDB_id=856345 Q0M94_RS03615 WP_407540499.1 677432..677635(+) (comEC) [Deinococcus radiomollis strain PO-04-20-132]
MLKTAHHGSRFSSGEAFLAETQPQNAVISVGRNTYGHPNDDLLARLAARNVKVWRTDRVGTIRWPIP
MLKTAHHGSRFSSGEAFLAETQPQNAVISVGRNTYGHPNDDLLARLAARNVKVWRTDRVGTIRWPIP
Nucleotide
Download Length: 204 bp
>NTDB_id=856345 Q0M94_RS03615 WP_407540499.1 677432..677635(+) (comEC) [Deinococcus radiomollis strain PO-04-20-132]
TTGCTGAAGACCGCACACCACGGCAGCCGGTTTTCCAGCGGCGAGGCGTTTCTGGCCGAGACGCAGCCACAGAACGCGGT
CATCAGCGTGGGGCGCAACACCTACGGGCACCCGAACGACGACCTGCTGGCGCGGCTGGCGGCCCGGAACGTGAAGGTCT
GGCGGACCGACCGAGTGGGCACCATCAGGTGGCCGATTCCGTAG
TTGCTGAAGACCGCACACCACGGCAGCCGGTTTTCCAGCGGCGAGGCGTTTCTGGCCGAGACGCAGCCACAGAACGCGGT
CATCAGCGTGGGGCGCAACACCTACGGGCACCCGAACGACGACCTGCTGGCGCGGCTGGCGGCCCGGAACGTGAAGGTCT
GGCGGACCGACCGAGTGGGCACCATCAGGTGGCCGATTCCGTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEC | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
62.687 |
100 |
0.627 |
| comEC | Lactococcus lactis subsp. cremoris KW2 |
50 |
95.522 |
0.478 |
| comA | Ralstonia pseudosolanacearum GMI1000 |
46.032 |
94.03 |
0.433 |
| comEC | Bacillus subtilis subsp. subtilis str. 168 |
44.615 |
97.015 |
0.433 |
| comEC/celB | Streptococcus mitis SK321 |
44.615 |
97.015 |
0.433 |
| comEC/celB | Streptococcus pneumoniae Rx1 |
43.077 |
97.015 |
0.418 |
| comEC/celB | Streptococcus mitis NCTC 12261 |
43.077 |
97.015 |
0.418 |
| comEC/celB | Streptococcus pneumoniae TIGR4 |
43.077 |
97.015 |
0.418 |
| comEC/celB | Streptococcus pneumoniae D39 |
43.077 |
97.015 |
0.418 |
| comEC/celB | Streptococcus pneumoniae R6 |
43.077 |
97.015 |
0.418 |
| comA/comEC | Acinetobacter baumannii D1279779 |
40 |
97.015 |
0.388 |
| comA/comEC | Acinetobacter baumannii strain A118 |
40 |
97.015 |
0.388 |
| comA/comEC | Thermus thermophilus HB27 |
41.935 |
92.537 |
0.388 |
| comEC | Latilactobacillus sakei subsp. sakei 23K |
39.062 |
95.522 |
0.373 |
| comA | Neisseria gonorrhoeae MS11 |
39.062 |
95.522 |
0.373 |