Detailed information NTG0854214

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QYT32_RS01800
• Genome accession: NZ_CP129553
• Coordinates: 338247..338558 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472257.1
• Uniprot ID: A0A115HMG3
• Organism: Staphylococcus aureus strain 704D
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 333247..343558

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QYT32_RS01770 (QYT32_01765)	-	334030..334233 (+)	204	WP_000087561.1	YqgQ family protein	-
QYT32_RS01775 (QYT32_01770)	-	334230..335216 (+)	987	WP_000161314.1	ROK family glucokinase	-
QYT32_RS01780 (QYT32_01775)	-	335216..335545 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
QYT32_RS01785 (QYT32_01780)	-	335542..336165 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
QYT32_RS01790 (QYT32_01785)	comGA	336217..337191 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
QYT32_RS01795 (QYT32_01790)	comGB	337163..338254 (+)	1092	WP_123089976.1	competence type IV pilus assembly protein ComGB	Machinery gene
QYT32_RS01800 (QYT32_01795)	comGC	338247..338558 (+)	312	WP_000472257.1	competence type IV pilus major pilin ComGC	Machinery gene
QYT32_RS01805 (QYT32_01800)	comGD	338536..338982 (+)	447	WP_001791207.1	competence type IV pilus minor pilin ComGD	Machinery gene
QYT32_RS01810 (QYT32_01805)	comGE	338969..339268 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
QYT32_RS01815 (QYT32_01810)	comGF	339186..339683 (+)	498	WP_001794328.1	competence type IV pilus minor pilin ComGF	Machinery gene
QYT32_RS01820 (QYT32_01815)	-	339780..339926 (+)	147	WP_001789879.1	hypothetical protein	-
QYT32_RS01825 (QYT32_01820)	-	339916..340440 (+)	525	WP_001015125.1	shikimate kinase	-
QYT32_RS01830 (QYT32_01825)	gcvT	340599..341690 (+)	1092	WP_123089974.1	glycine cleavage system aminomethyltransferase GcvT	-
QYT32_RS01835 (QYT32_01830)	gcvPA	341710..343056 (+)	1347	WP_000019697.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11373.39 Da
• Isoelectric Point: 7.8600

>NTDB_id=854214 QYT32_RS01800 WP_000472257.1 338247..338558(+) (comGC) [Staphylococcus aureus strain 704D]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=854214 QYT32_RS01800 WP_000472257.1 338247..338558(+) (comGC) [Staphylococcus aureus strain 704D]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A115HMG3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	48.039	99.029	0.476
comGC/cglC	Streptococcus pneumoniae R6	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae D39	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae TIGR4	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae Rx1	47.059	99.029	0.466
comGC/cglC	Streptococcus mitis NCTC 12261	52.326	83.495	0.437
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comYC	Streptococcus mutans UA140	50	73.786	0.369
comYC	Streptococcus mutans UA159	50	73.786	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369