Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QY867_RS04375 | Genome accession | NZ_CP129529 |
| Coordinates | 861867..862310 (+) | Length | 147 a.a. |
| NCBI ID | WP_341844054.1 | Uniprot ID | - |
| Organism | Latilactobacillus sakei strain A1291 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 851512..911084 | 861867..862310 | within | 0 |
Gene organization within MGE regions
Location: 851512..911084
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QY867_RS04280 (QY867_04275) | - | 851512..852657 (-) | 1146 | WP_341844042.1 | tyrosine-type recombinase/integrase | - |
| QY867_RS04285 (QY867_04280) | - | 852773..853762 (-) | 990 | WP_341844043.1 | Abi family protein | - |
| QY867_RS04290 (QY867_04285) | - | 853878..854360 (-) | 483 | WP_341844044.1 | hypothetical protein | - |
| QY867_RS04300 (QY867_04295) | - | 854491..855051 (-) | 561 | WP_341844045.1 | DUF4352 domain-containing protein | - |
| QY867_RS04305 (QY867_04300) | - | 855178..855573 (-) | 396 | WP_341844108.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QY867_RS04310 (QY867_04305) | - | 855605..855967 (-) | 363 | WP_254680984.1 | helix-turn-helix domain-containing protein | - |
| QY867_RS04315 (QY867_04310) | - | 856238..856432 (+) | 195 | WP_254680983.1 | transcriptional regulator | - |
| QY867_RS04320 (QY867_04315) | - | 856459..857196 (+) | 738 | WP_341844046.1 | Rha family transcriptional regulator | - |
| QY867_RS04325 (QY867_04320) | - | 857213..857404 (+) | 192 | WP_341844047.1 | hypothetical protein | - |
| QY867_RS04330 (QY867_04325) | - | 857418..857732 (+) | 315 | WP_341844048.1 | DUF771 domain-containing protein | - |
| QY867_RS04335 (QY867_04330) | - | 857734..857925 (+) | 192 | WP_341844049.1 | hypothetical protein | - |
| QY867_RS04340 (QY867_04335) | - | 857991..858260 (+) | 270 | WP_341844050.1 | hypothetical protein | - |
| QY867_RS04345 (QY867_04340) | - | 858263..858895 (+) | 633 | WP_341844051.1 | ERF family protein | - |
| QY867_RS04350 (QY867_04345) | - | 858898..859629 (+) | 732 | WP_341844052.1 | putative HNHc nuclease | - |
| QY867_RS04355 (QY867_04350) | - | 859619..860314 (+) | 696 | WP_341844053.1 | conserved phage C-terminal domain-containing protein | - |
| QY867_RS04360 (QY867_04355) | - | 860295..861131 (+) | 837 | WP_056948420.1 | ATP-binding protein | - |
| QY867_RS04365 (QY867_04360) | - | 861240..861653 (+) | 414 | WP_099769375.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QY867_RS04370 (QY867_04365) | - | 861643..861855 (+) | 213 | WP_056948424.1 | hypothetical protein | - |
| QY867_RS04375 (QY867_04370) | ssb | 861867..862310 (+) | 444 | WP_341844054.1 | single-stranded DNA-binding protein | Machinery gene |
| QY867_RS04380 (QY867_04375) | - | 862324..863019 (+) | 696 | WP_341844055.1 | hypothetical protein | - |
| QY867_RS04385 (QY867_04380) | - | 863469..864482 (+) | 1014 | WP_341844079.1 | DNA cytosine methyltransferase | - |
| QY867_RS04390 (QY867_04385) | - | 864599..864934 (+) | 336 | WP_341844056.1 | hypothetical protein | - |
| QY867_RS04395 (QY867_04390) | - | 864934..865092 (+) | 159 | WP_341844057.1 | hypothetical protein | - |
| QY867_RS04400 (QY867_04395) | - | 865073..865486 (+) | 414 | WP_341844058.1 | transcriptional regulator | - |
| QY867_RS04405 (QY867_04400) | - | 865853..866440 (+) | 588 | WP_099769385.1 | hypothetical protein | - |
| QY867_RS04410 (QY867_04405) | - | 867064..867357 (+) | 294 | WP_341844059.1 | hypothetical protein | - |
| QY867_RS04415 (QY867_04410) | - | 867354..867683 (+) | 330 | WP_271259878.1 | HNH endonuclease | - |
| QY867_RS04420 (QY867_04415) | - | 867796..868146 (+) | 351 | WP_341844060.1 | P27 family phage terminase small subunit | - |
| QY867_RS04425 (QY867_04420) | - | 868136..869776 (+) | 1641 | WP_341844061.1 | terminase large subunit | - |
| QY867_RS04430 (QY867_04425) | - | 869792..871081 (+) | 1290 | WP_341844062.1 | phage portal protein | - |
| QY867_RS04435 (QY867_04430) | - | 871056..871772 (+) | 717 | WP_341844063.1 | head maturation protease, ClpP-related | - |
| QY867_RS04440 (QY867_04435) | - | 871786..873051 (+) | 1266 | WP_341844064.1 | phage major capsid protein | - |
| QY867_RS04445 (QY867_04440) | - | 873052..873369 (+) | 318 | WP_341844065.1 | hypothetical protein | - |
| QY867_RS04450 (QY867_04445) | - | 873686..874057 (+) | 372 | WP_341844066.1 | hypothetical protein | - |
| QY867_RS04455 (QY867_04450) | - | 874057..874467 (+) | 411 | WP_341844067.1 | hypothetical protein | - |
| QY867_RS04460 (QY867_04455) | - | 874480..875097 (+) | 618 | WP_341844068.1 | phage tail protein | - |
| QY867_RS04465 (QY867_04460) | - | 875100..875462 (+) | 363 | WP_341844069.1 | hypothetical protein | - |
| QY867_RS04470 (QY867_04465) | - | 875786..879247 (+) | 3462 | WP_341844109.1 | phage tail tape measure protein | - |
| QY867_RS04475 (QY867_04470) | - | 879247..879933 (+) | 687 | WP_341844071.1 | hypothetical protein | - |
| QY867_RS04480 (QY867_04475) | - | 879930..886487 (+) | 6558 | WP_341844072.1 | phage tail spike protein | - |
| QY867_RS04485 (QY867_04480) | - | 886484..886933 (+) | 450 | WP_341843892.1 | DUF1617 family protein | - |
| QY867_RS04490 (QY867_04485) | - | 886933..887160 (+) | 228 | WP_341843893.1 | hypothetical protein | - |
| QY867_RS04495 (QY867_04490) | - | 887179..887652 (+) | 474 | WP_241424803.1 | phage holin family protein | - |
| QY867_RS04500 (QY867_04495) | - | 887649..887927 (+) | 279 | WP_065825522.1 | hypothetical protein | - |
| QY867_RS04505 (QY867_04500) | - | 887927..888736 (+) | 810 | WP_341843894.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QY867_RS04510 (QY867_04505) | - | 888874..889473 (+) | 600 | WP_251930926.1 | hypothetical protein | - |
| QY867_RS04515 (QY867_04510) | - | 889521..889877 (+) | 357 | WP_099769402.1 | hypothetical protein | - |
| QY867_RS04520 (QY867_04515) | - | 889903..890316 (+) | 414 | WP_099769403.1 | protein-export chaperone SecB | - |
| QY867_RS04525 (QY867_04520) | - | 890751..891116 (-) | 366 | WP_011374991.1 | DUF805 domain-containing protein | - |
| QY867_RS04530 (QY867_04525) | - | 891242..892048 (-) | 807 | WP_341843895.1 | TraX family protein | - |
| QY867_RS04535 (QY867_04530) | - | 892184..893020 (-) | 837 | WP_337457509.1 | DNA/RNA non-specific endonuclease | - |
| QY867_RS04540 (QY867_04535) | - | 893022..893552 (-) | 531 | WP_016265368.1 | hypothetical protein | - |
| QY867_RS04545 (QY867_04540) | - | 893657..893968 (-) | 312 | WP_056947116.1 | hypothetical protein | - |
| QY867_RS04550 (QY867_04545) | - | 894112..894255 (+) | 144 | WP_011374986.1 | hypothetical protein | - |
| QY867_RS04555 (QY867_04550) | lepA | 894390..896228 (+) | 1839 | WP_337457510.1 | translation elongation factor 4 | - |
| QY867_RS04560 (QY867_04555) | - | 896268..896462 (-) | 195 | WP_011374984.1 | hypothetical protein | - |
| QY867_RS04565 (QY867_04560) | - | 896609..897118 (+) | 510 | WP_341844080.1 | DinB family protein | - |
| QY867_RS04570 (QY867_04565) | - | 897265..897876 (+) | 612 | WP_011374982.1 | WxL domain-containing protein | - |
| QY867_RS04575 (QY867_04570) | - | 897997..899040 (+) | 1044 | WP_341843896.1 | DUF916 and DUF3324 domain-containing protein | - |
| QY867_RS04580 (QY867_04575) | - | 899030..899425 (+) | 396 | WP_016265361.1 | LPXTG cell wall anchor domain-containing protein | - |
| QY867_RS04585 (QY867_04580) | - | 899415..901133 (+) | 1719 | WP_061827024.1 | WxL domain-containing protein | - |
| QY867_RS04590 (QY867_04585) | - | 901184..901510 (-) | 327 | WP_337457512.1 | heavy metal-binding domain-containing protein | - |
| QY867_RS04595 (QY867_04590) | - | 901527..901892 (-) | 366 | WP_011374976.1 | DUF1304 domain-containing protein | - |
| QY867_RS04600 (QY867_04595) | galE | 901978..902970 (-) | 993 | WP_035146095.1 | UDP-glucose 4-epimerase GalE | - |
| QY867_RS04605 (QY867_04600) | recJ | 903115..905427 (+) | 2313 | WP_341843897.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QY867_RS04610 (QY867_04605) | - | 905451..905969 (+) | 519 | WP_011374973.1 | adenine phosphoribosyltransferase | - |
| QY867_RS04615 (QY867_04610) | lexA | 906103..906717 (-) | 615 | WP_011374972.1 | transcriptional repressor LexA | - |
| QY867_RS04620 (QY867_04615) | - | 906852..907094 (+) | 243 | WP_011374971.1 | DUF896 domain-containing protein | - |
| QY867_RS04625 (QY867_04620) | - | 907175..907405 (+) | 231 | WP_011374970.1 | YneF family protein | - |
| QY867_RS04630 (QY867_04625) | - | 907547..909292 (+) | 1746 | WP_341843898.1 | ABC transporter transmembrane domain-containing protein | - |
| QY867_RS04635 (QY867_04630) | - | 909294..911084 (+) | 1791 | WP_337457514.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16285.99 Da Isoelectric Point: 6.9816
>NTDB_id=854066 QY867_RS04375 WP_341844054.1 861867..862310(+) (ssb) [Latilactobacillus sakei strain A1291]
MINRVILIGRLTKDPELKYTSSGAAVGSFNLAVNRQFTNANGDREADFINCVIWRKSAENFANFTHKGSLVGIDGRLQTR
NYENKQGQRIYVTEVVVDNFSLLEKRASDNSNANQTQAGSNQTQSKPTDPFAGNGRAIDINDDDLPF
MINRVILIGRLTKDPELKYTSSGAAVGSFNLAVNRQFTNANGDREADFINCVIWRKSAENFANFTHKGSLVGIDGRLQTR
NYENKQGQRIYVTEVVVDNFSLLEKRASDNSNANQTQAGSNQTQSKPTDPFAGNGRAIDINDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=854066 QY867_RS04375 WP_341844054.1 861867..862310(+) (ssb) [Latilactobacillus sakei strain A1291]
ATGATTAACAGAGTAATTCTAATAGGGCGATTGACAAAAGACCCAGAGCTTAAATATACGTCGTCAGGTGCAGCGGTTGG
CTCGTTTAACTTAGCTGTTAACCGCCAGTTTACAAATGCCAATGGTGACCGTGAAGCGGACTTTATTAATTGTGTTATCT
GGCGTAAATCAGCGGAAAACTTTGCTAACTTTACGCACAAAGGTTCATTGGTGGGGATTGACGGCCGTCTCCAAACGAGA
AATTACGAAAACAAACAAGGTCAACGCATTTATGTGACCGAGGTCGTAGTAGATAACTTTAGTTTACTTGAAAAAAGAGC
GTCCGATAATTCGAACGCAAATCAGACGCAAGCCGGAAGCAATCAGACGCAAAGCAAGCCAACTGATCCATTCGCTGGTA
ACGGGCGAGCGATTGATATTAATGATGATGATTTACCATTCTAG
ATGATTAACAGAGTAATTCTAATAGGGCGATTGACAAAAGACCCAGAGCTTAAATATACGTCGTCAGGTGCAGCGGTTGG
CTCGTTTAACTTAGCTGTTAACCGCCAGTTTACAAATGCCAATGGTGACCGTGAAGCGGACTTTATTAATTGTGTTATCT
GGCGTAAATCAGCGGAAAACTTTGCTAACTTTACGCACAAAGGTTCATTGGTGGGGATTGACGGCCGTCTCCAAACGAGA
AATTACGAAAACAAACAAGGTCAACGCATTTATGTGACCGAGGTCGTAGTAGATAACTTTAGTTTACTTGAAAAAAGAGC
GTCCGATAATTCGAACGCAAATCAGACGCAAGCCGGAAGCAATCAGACGCAAAGCAAGCCAACTGATCCATTCGCTGGTA
ACGGGCGAGCGATTGATATTAATGATGATGATTTACCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
70 |
100 |
0.81 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.639 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.537 |
100 |
0.435 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
75.51 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
53.271 |
72.789 |
0.388 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
53.271 |
72.789 |
0.388 |
| ssb | Vibrio cholerae strain A1552 |
32.37 |
100 |
0.381 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
52.336 |
72.789 |
0.381 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
52.336 |
72.789 |
0.381 |
| ssbB/cilA | Streptococcus mitis SK321 |
52.336 |
72.789 |
0.381 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
52.336 |
72.789 |
0.381 |
| ssbA | Streptococcus mutans UA159 |
45.299 |
79.592 |
0.361 |