Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLNCDO702_RS10440 | Genome accession | NZ_CP129159 |
| Coordinates | 2094136..2094561 (-) | Length | 141 a.a. |
| NCBI ID | WP_014570750.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain NCDO702 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2060454..2105872 | 2094136..2094561 | within | 0 |
Gene organization within MGE regions
Location: 2060454..2105872
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLNCDO702_RS10190 (LLNCDO702_10180) | pknB | 2060454..2062337 (-) | 1884 | WP_003130801.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| LLNCDO702_RS10195 (LLNCDO702_10185) | - | 2062337..2063113 (-) | 777 | WP_003130802.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LLNCDO702_RS10200 (LLNCDO702_10190) | rsmB | 2063194..2064468 (-) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LLNCDO702_RS10205 (LLNCDO702_10195) | - | 2065422..2066201 (-) | 780 | WP_014570716.1 | peptidoglycan amidohydrolase family protein | - |
| LLNCDO702_RS10210 (LLNCDO702_10200) | - | 2066201..2066488 (-) | 288 | WP_014570717.1 | phage holin | - |
| LLNCDO702_RS10215 (LLNCDO702_10205) | - | 2066501..2066851 (-) | 351 | WP_014570718.1 | hypothetical protein | - |
| LLNCDO702_RS10220 (LLNCDO702_10210) | - | 2066966..2067154 (-) | 189 | WP_124175178.1 | hypothetical protein | - |
| LLNCDO702_RS10225 (LLNCDO702_10215) | - | 2067241..2069598 (-) | 2358 | WP_014570720.1 | BppU family phage baseplate upper protein | - |
| LLNCDO702_RS10230 (LLNCDO702_10220) | - | 2069616..2072369 (-) | 2754 | WP_014570721.1 | phage tail spike protein | - |
| LLNCDO702_RS10235 (LLNCDO702_10225) | - | 2072369..2073130 (-) | 762 | WP_014570722.1 | distal tail protein Dit | - |
| LLNCDO702_RS10240 (LLNCDO702_10230) | - | 2073140..2075953 (-) | 2814 | WP_014570723.1 | phage tail tape measure protein | - |
| LLNCDO702_RS10245 (LLNCDO702_10235) | - | 2075967..2076287 (-) | 321 | WP_371400166.1 | hypothetical protein | - |
| LLNCDO702_RS10250 (LLNCDO702_10240) | - | 2076326..2076661 (-) | 336 | WP_014570725.1 | tail assembly chaperone | - |
| LLNCDO702_RS10255 (LLNCDO702_10245) | - | 2076777..2077274 (-) | 498 | WP_014570726.1 | phage major tail protein, TP901-1 family | - |
| LLNCDO702_RS10260 (LLNCDO702_10250) | - | 2077285..2077680 (-) | 396 | WP_014570727.1 | hypothetical protein | - |
| LLNCDO702_RS10265 (LLNCDO702_10255) | - | 2077677..2078015 (-) | 339 | WP_014570728.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LLNCDO702_RS10270 (LLNCDO702_10260) | - | 2078012..2078323 (-) | 312 | WP_003131945.1 | hypothetical protein | - |
| LLNCDO702_RS10275 (LLNCDO702_10265) | - | 2078320..2078652 (-) | 333 | WP_003131944.1 | phage head-tail connector protein | - |
| LLNCDO702_RS10280 (LLNCDO702_10270) | - | 2078639..2078836 (-) | 198 | WP_014570729.1 | HeH/LEM domain-containing protein | - |
| LLNCDO702_RS10285 (LLNCDO702_10275) | - | 2078836..2079657 (-) | 822 | WP_058207139.1 | N4-gp56 family major capsid protein | - |
| LLNCDO702_RS10290 (LLNCDO702_10280) | - | 2079659..2080321 (-) | 663 | WP_081144361.1 | DUF4355 domain-containing protein | - |
| LLNCDO702_RS10295 (LLNCDO702_10285) | - | 2080436..2080690 (-) | 255 | WP_014570732.1 | hypothetical protein | - |
| LLNCDO702_RS10300 (LLNCDO702_10290) | - | 2080687..2080914 (-) | 228 | WP_014570733.1 | hypothetical protein | - |
| LLNCDO702_RS10305 (LLNCDO702_10295) | - | 2080929..2081639 (-) | 711 | WP_014570734.1 | hypothetical protein | - |
| LLNCDO702_RS10310 (LLNCDO702_10300) | - | 2081679..2082623 (-) | 945 | WP_014570735.1 | minor capsid protein | - |
| LLNCDO702_RS10315 (LLNCDO702_10305) | - | 2082627..2082815 (-) | 189 | WP_025016873.1 | hypothetical protein | - |
| LLNCDO702_RS10320 (LLNCDO702_10310) | - | 2082802..2084190 (-) | 1389 | WP_014570736.1 | phage portal protein | - |
| LLNCDO702_RS10325 (LLNCDO702_10315) | terL | 2084204..2085592 (-) | 1389 | WP_014570737.1 | phage terminase large subunit | - |
| LLNCDO702_RS10330 (LLNCDO702_10320) | - | 2085585..2086001 (-) | 417 | WP_003131930.1 | hypothetical protein | - |
| LLNCDO702_RS10340 (LLNCDO702_10330) | - | 2086357..2086779 (-) | 423 | WP_010905372.1 | RinA family protein | - |
| LLNCDO702_RS10345 (LLNCDO702_10335) | - | 2087304..2087459 (-) | 156 | WP_043991164.1 | hypothetical protein | - |
| LLNCDO702_RS10350 (LLNCDO702_10340) | - | 2087456..2087641 (-) | 186 | WP_014570738.1 | hypothetical protein | - |
| LLNCDO702_RS10355 (LLNCDO702_10345) | - | 2087649..2087852 (-) | 204 | WP_014570739.1 | hypothetical protein | - |
| LLNCDO702_RS10360 | - | 2087852..2087974 (-) | 123 | WP_014570740.1 | hypothetical protein | - |
| LLNCDO702_RS10365 (LLNCDO702_10350) | - | 2087975..2088151 (-) | 177 | WP_043991165.1 | DUF1660 domain-containing protein | - |
| LLNCDO702_RS10370 (LLNCDO702_10355) | - | 2088148..2088291 (-) | 144 | WP_010905362.1 | hypothetical protein | - |
| LLNCDO702_RS10375 (LLNCDO702_10360) | - | 2088369..2089049 (-) | 681 | WP_063283376.1 | hypothetical protein | - |
| LLNCDO702_RS10380 (LLNCDO702_10365) | - | 2089076..2089348 (-) | 273 | WP_014570742.1 | hypothetical protein | - |
| LLNCDO702_RS10385 (LLNCDO702_10370) | - | 2089352..2089771 (-) | 420 | WP_003129863.1 | dUTP diphosphatase | - |
| LLNCDO702_RS10390 (LLNCDO702_10375) | - | 2089768..2090442 (-) | 675 | WP_014570539.1 | DUF1642 domain-containing protein | - |
| LLNCDO702_RS10395 (LLNCDO702_10380) | - | 2090435..2090614 (-) | 180 | WP_043991166.1 | hypothetical protein | - |
| LLNCDO702_RS10400 (LLNCDO702_10385) | - | 2090611..2090811 (-) | 201 | WP_014570743.1 | DUF1125 domain-containing protein | - |
| LLNCDO702_RS10405 (LLNCDO702_10390) | - | 2091003..2091209 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LLNCDO702_RS10410 (LLNCDO702_10395) | - | 2091320..2091559 (-) | 240 | WP_014570744.1 | DUF1031 family protein | - |
| LLNCDO702_RS10415 (LLNCDO702_10400) | - | 2091552..2091746 (-) | 195 | WP_014570745.1 | hypothetical protein | - |
| LLNCDO702_RS10420 (LLNCDO702_10405) | - | 2091749..2092138 (-) | 390 | WP_014570746.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLNCDO702_RS10425 (LLNCDO702_10410) | - | 2092128..2092292 (-) | 165 | WP_014570747.1 | hypothetical protein | - |
| LLNCDO702_RS10430 (LLNCDO702_10415) | - | 2092395..2093189 (-) | 795 | WP_237025328.1 | ATP-binding protein | - |
| LLNCDO702_RS10435 (LLNCDO702_10420) | - | 2093199..2094011 (-) | 813 | WP_081144362.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLNCDO702_RS10440 (LLNCDO702_10425) | ssb | 2094136..2094561 (-) | 426 | WP_014570750.1 | single-stranded DNA-binding protein | Machinery gene |
| LLNCDO702_RS10445 (LLNCDO702_10430) | - | 2094554..2095312 (-) | 759 | WP_014570751.1 | Rad52/Rad22 family DNA repair protein | - |
| LLNCDO702_RS10450 (LLNCDO702_10435) | - | 2095321..2095839 (-) | 519 | WP_014570752.1 | host-nuclease inhibitor Gam family protein | - |
| LLNCDO702_RS10455 (LLNCDO702_10440) | - | 2095939..2096166 (-) | 228 | WP_014570753.1 | hypothetical protein | - |
| LLNCDO702_RS10460 (LLNCDO702_10445) | - | 2096168..2096368 (-) | 201 | WP_014570754.1 | helix-turn-helix transcriptional regulator | - |
| LLNCDO702_RS10465 (LLNCDO702_10450) | - | 2096519..2096797 (+) | 279 | WP_014570755.1 | DUF3892 domain-containing protein | - |
| LLNCDO702_RS10470 (LLNCDO702_10455) | - | 2096827..2097021 (-) | 195 | WP_014570756.1 | hypothetical protein | - |
| LLNCDO702_RS10475 (LLNCDO702_10460) | - | 2097116..2097385 (-) | 270 | WP_014570757.1 | hypothetical protein | - |
| LLNCDO702_RS10480 (LLNCDO702_10465) | - | 2097398..2098165 (-) | 768 | WP_014570758.1 | phage repressor protein/antirepressor Ant | - |
| LLNCDO702_RS10485 (LLNCDO702_10470) | - | 2098178..2098417 (-) | 240 | WP_023189646.1 | helix-turn-helix transcriptional regulator | - |
| LLNCDO702_RS10490 (LLNCDO702_10475) | - | 2098523..2098780 (+) | 258 | WP_014570760.1 | hypothetical protein | - |
| LLNCDO702_RS10495 (LLNCDO702_10480) | - | 2098770..2098979 (-) | 210 | WP_014570761.1 | hypothetical protein | - |
| LLNCDO702_RS10500 (LLNCDO702_10485) | - | 2099134..2099676 (+) | 543 | WP_014570762.1 | hypothetical protein | - |
| LLNCDO702_RS10505 (LLNCDO702_10490) | - | 2099808..2100008 (-) | 201 | WP_014570763.1 | putative transcriptional regulator | - |
| LLNCDO702_RS10510 (LLNCDO702_10495) | - | 2100283..2100846 (+) | 564 | WP_014570764.1 | helix-turn-helix transcriptional regulator | - |
| LLNCDO702_RS10515 (LLNCDO702_10500) | - | 2100852..2101286 (+) | 435 | WP_014570765.1 | zinc peptidase | - |
| LLNCDO702_RS10520 (LLNCDO702_10505) | - | 2101300..2101635 (+) | 336 | WP_014570766.1 | hypothetical protein | - |
| LLNCDO702_RS10525 (LLNCDO702_10510) | - | 2101702..2102883 (+) | 1182 | WP_058207138.1 | site-specific integrase | - |
| LLNCDO702_RS10530 (LLNCDO702_10515) | - | 2103183..2103689 (-) | 507 | WP_003131479.1 | Asp23/Gls24 family envelope stress response protein | - |
| LLNCDO702_RS10535 (LLNCDO702_10520) | - | 2103710..2103898 (-) | 189 | WP_012898445.1 | DUF2273 domain-containing protein | - |
| LLNCDO702_RS10540 (LLNCDO702_10525) | amaP | 2103909..2104448 (-) | 540 | WP_031299493.1 | alkaline shock response membrane anchor protein AmaP | - |
| LLNCDO702_RS10545 (LLNCDO702_10530) | - | 2104496..2104738 (-) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| LLNCDO702_RS10550 (LLNCDO702_10535) | fmt | 2104913..2105872 (-) | 960 | WP_003131475.1 | methionyl-tRNA formyltransferase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15742.47 Da Isoelectric Point: 5.1972
>NTDB_id=851302 LLNCDO702_RS10440 WP_014570750.1 2094136..2094561(-) (ssb) [Lactococcus lactis subsp. lactis strain NCDO702]
MINNVTLVGRITKEPELRYTPQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVGNPASKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVGNPASKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=851302 LLNCDO702_RS10440 WP_014570750.1 2094136..2094561(-) (ssb) [Lactococcus lactis subsp. lactis strain NCDO702]
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTAGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGG
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTAGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGG
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.716 |
100 |
0.397 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |