Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLNCDO702_RS02505 | Genome accession | NZ_CP129159 |
| Coordinates | 483608..484033 (+) | Length | 141 a.a. |
| NCBI ID | WP_015967987.1 | Uniprot ID | A0A1V0NDX0 |
| Organism | Lactococcus lactis subsp. lactis strain NCDO702 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 476574..528754 | 483608..484033 | within | 0 |
Gene organization within MGE regions
Location: 476574..528754
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLNCDO702_RS02435 (LLNCDO702_02445) | - | 476574..477708 (-) | 1135 | Protein_466 | tyrosine-type recombinase/integrase | - |
| LLNCDO702_RS02440 (LLNCDO702_02450) | - | 477760..478620 (-) | 861 | WP_081144184.1 | S24 family peptidase | - |
| LLNCDO702_RS02445 | - | 479021..479221 (-) | 201 | WP_371400164.1 | hypothetical protein | - |
| LLNCDO702_RS02450 (LLNCDO702_02460) | - | 479384..479746 (-) | 363 | WP_081144188.1 | hypothetical protein | - |
| LLNCDO702_RS02455 (LLNCDO702_02465) | - | 479784..479993 (+) | 210 | WP_081144190.1 | hypothetical protein | - |
| LLNCDO702_RS02460 (LLNCDO702_02470) | - | 480018..480248 (+) | 231 | WP_015966797.1 | helix-turn-helix transcriptional regulator | - |
| LLNCDO702_RS02465 (LLNCDO702_02475) | - | 480260..480478 (+) | 219 | WP_011834773.1 | hypothetical protein | - |
| LLNCDO702_RS02470 (LLNCDO702_02480) | - | 480488..481201 (+) | 714 | WP_081144192.1 | ORF6C domain-containing protein | - |
| LLNCDO702_RS02475 (LLNCDO702_02485) | - | 481214..481546 (+) | 333 | WP_081144194.1 | DUF771 domain-containing protein | - |
| LLNCDO702_RS02480 (LLNCDO702_02490) | - | 481684..481908 (+) | 225 | WP_032399005.1 | hypothetical protein | - |
| LLNCDO702_RS02485 (LLNCDO702_02495) | - | 481905..482099 (+) | 195 | WP_081144195.1 | hypothetical protein | - |
| LLNCDO702_RS02490 (LLNCDO702_02500) | - | 482109..482351 (+) | 243 | WP_032399006.1 | hypothetical protein | - |
| LLNCDO702_RS02495 (LLNCDO702_02505) | - | 482453..482848 (+) | 396 | WP_003132838.1 | hypothetical protein | - |
| LLNCDO702_RS02500 (LLNCDO702_02510) | - | 482857..483615 (+) | 759 | WP_081144196.1 | Rad52/Rad22 family DNA repair protein | - |
| LLNCDO702_RS02505 (LLNCDO702_02515) | ssb | 483608..484033 (+) | 426 | WP_015967987.1 | single-stranded DNA-binding protein | Machinery gene |
| LLNCDO702_RS02510 (LLNCDO702_02520) | - | 484158..484940 (+) | 783 | WP_023189114.1 | phage replisome organiser protein | - |
| LLNCDO702_RS02515 (LLNCDO702_02525) | - | 484940..485665 (+) | 726 | WP_081144197.1 | hypothetical protein | - |
| LLNCDO702_RS02520 (LLNCDO702_02530) | - | 485662..486051 (+) | 390 | WP_081144198.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLNCDO702_RS02525 (LLNCDO702_02535) | - | 486054..486296 (+) | 243 | WP_081144199.1 | DUF1031 family protein | - |
| LLNCDO702_RS02530 (LLNCDO702_02540) | - | 486404..486559 (+) | 156 | WP_081144200.1 | hypothetical protein | - |
| LLNCDO702_RS02535 (LLNCDO702_02545) | - | 486549..487118 (+) | 570 | WP_081144201.1 | DUF658 family protein | - |
| LLNCDO702_RS02540 (LLNCDO702_02550) | - | 487312..487518 (+) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LLNCDO702_RS02545 (LLNCDO702_02555) | - | 487511..488203 (+) | 693 | WP_081144202.1 | DUF1642 domain-containing protein | - |
| LLNCDO702_RS02550 (LLNCDO702_02560) | - | 488200..488619 (+) | 420 | WP_081144203.1 | dUTP diphosphatase | - |
| LLNCDO702_RS02555 (LLNCDO702_02565) | - | 488622..489152 (+) | 531 | WP_237025330.1 | hypothetical protein | - |
| LLNCDO702_RS02560 (LLNCDO702_02570) | - | 489149..489829 (+) | 681 | WP_081144204.1 | hypothetical protein | - |
| LLNCDO702_RS02565 (LLNCDO702_02575) | - | 489876..490094 (+) | 219 | WP_015967997.1 | hypothetical protein | - |
| LLNCDO702_RS02570 (LLNCDO702_02580) | - | 490091..490291 (+) | 201 | WP_081144205.1 | DUF1660 domain-containing protein | - |
| LLNCDO702_RS02575 (LLNCDO702_02585) | - | 490472..490654 (+) | 183 | WP_015967999.1 | hypothetical protein | - |
| LLNCDO702_RS02580 (LLNCDO702_02590) | - | 490651..490830 (+) | 180 | WP_015968000.1 | hypothetical protein | - |
| LLNCDO702_RS02585 (LLNCDO702_02595) | - | 490968..491432 (+) | 465 | WP_015968001.1 | hypothetical protein | - |
| LLNCDO702_RS02590 (LLNCDO702_02600) | - | 491680..492102 (+) | 423 | WP_014573151.1 | RinA family protein | - |
| LLNCDO702_RS02595 (LLNCDO702_02605) | - | 492329..492535 (+) | 207 | WP_025017211.1 | helix-turn-helix domain-containing protein | - |
| LLNCDO702_RS02600 (LLNCDO702_02610) | - | 492548..493051 (+) | 504 | WP_081144207.1 | HNH endonuclease | - |
| LLNCDO702_RS02605 (LLNCDO702_02615) | - | 493211..493606 (+) | 396 | WP_047687184.1 | phage terminase small subunit P27 family | - |
| LLNCDO702_RS02610 (LLNCDO702_02620) | - | 493606..495420 (+) | 1815 | WP_081144208.1 | terminase large subunit | - |
| LLNCDO702_RS02615 (LLNCDO702_02625) | - | 495429..495593 (+) | 165 | WP_058221580.1 | hypothetical protein | - |
| LLNCDO702_RS02620 (LLNCDO702_02630) | - | 495590..496669 (+) | 1080 | WP_023164518.1 | phage portal protein | - |
| LLNCDO702_RS02625 (LLNCDO702_02635) | - | 496669..497256 (+) | 588 | WP_010905378.1 | HK97 family phage prohead protease | - |
| LLNCDO702_RS02630 (LLNCDO702_02640) | - | 497246..498559 (+) | 1314 | WP_081144209.1 | phage major capsid protein | - |
| LLNCDO702_RS02635 (LLNCDO702_02645) | - | 498570..498875 (+) | 306 | WP_081144210.1 | head-tail connector protein | - |
| LLNCDO702_RS02640 (LLNCDO702_02650) | - | 498862..499197 (+) | 336 | WP_081144211.1 | phage head closure protein | - |
| LLNCDO702_RS02645 (LLNCDO702_02655) | - | 499197..499679 (+) | 483 | WP_237025331.1 | HK97 gp10 family phage protein | - |
| LLNCDO702_RS02650 (LLNCDO702_02660) | - | 499676..500071 (+) | 396 | WP_010905383.1 | DUF806 family protein | - |
| LLNCDO702_RS02655 (LLNCDO702_02665) | - | 500073..500678 (+) | 606 | WP_081144213.1 | phage tail protein | - |
| LLNCDO702_RS02660 (LLNCDO702_02670) | - | 500738..501082 (+) | 345 | WP_081144214.1 | phage tail tube assembly chaperone | - |
| LLNCDO702_RS02665 (LLNCDO702_02675) | - | 501100..501270 (+) | 171 | WP_021166226.1 | hypothetical protein | - |
| LLNCDO702_RS02670 (LLNCDO702_02680) | - | 501288..505091 (+) | 3804 | WP_237025332.1 | tape measure protein | - |
| LLNCDO702_RS02675 (LLNCDO702_02685) | - | 505094..506638 (+) | 1545 | WP_081144216.1 | distal tail protein Dit | - |
| LLNCDO702_RS02680 (LLNCDO702_02690) | - | 506638..511605 (+) | 4968 | WP_237025333.1 | hypothetical protein | - |
| LLNCDO702_RS02685 (LLNCDO702_02695) | - | 511617..511853 (+) | 237 | WP_081144217.1 | hypothetical protein | - |
| LLNCDO702_RS02690 (LLNCDO702_02700) | - | 511866..512216 (+) | 351 | WP_014570798.1 | hypothetical protein | - |
| LLNCDO702_RS02695 (LLNCDO702_02705) | - | 512229..512528 (+) | 300 | WP_010905918.1 | phage holin | - |
| LLNCDO702_RS02700 (LLNCDO702_02710) | - | 512530..512748 (+) | 219 | WP_081144218.1 | hypothetical protein | - |
| LLNCDO702_RS02705 (LLNCDO702_02715) | - | 512748..513527 (+) | 780 | WP_081144219.1 | peptidoglycan amidohydrolase family protein | - |
| LLNCDO702_RS02715 (LLNCDO702_02725) | truA | 514512..515273 (+) | 762 | WP_003131523.1 | tRNA pseudouridine(38-40) synthase TruA | - |
| LLNCDO702_RS02720 (LLNCDO702_02730) | - | 515306..516136 (+) | 831 | WP_003131522.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| LLNCDO702_RS02725 (LLNCDO702_02735) | - | 516133..516633 (+) | 501 | WP_003131521.1 | ECF transporter S component | - |
| LLNCDO702_RS02730 (LLNCDO702_02740) | - | 516614..517156 (+) | 543 | WP_003131520.1 | TIGR01440 family protein | - |
| LLNCDO702_RS02735 (LLNCDO702_02745) | - | 517157..518293 (+) | 1137 | WP_003131519.1 | alanine--glyoxylate aminotransferase family protein | - |
| LLNCDO702_RS02740 (LLNCDO702_02750) | - | 518528..520135 (+) | 1608 | WP_003131516.1 | CTP synthase | - |
| LLNCDO702_RS02745 (LLNCDO702_02755) | - | 520274..521187 (+) | 914 | Protein_527 | L-lactate dehydrogenase | - |
| LLNCDO702_RS02750 (LLNCDO702_02760) | - | 521219..522091 (-) | 873 | WP_003131512.1 | DUF1003 domain-containing protein | - |
| LLNCDO702_RS02755 (LLNCDO702_02765) | - | 522439..522639 (-) | 201 | WP_012897261.1 | YjzD family protein | - |
| LLNCDO702_RS02760 (LLNCDO702_02770) | - | 522737..523216 (-) | 480 | WP_010905396.1 | nucleoside 2-deoxyribosyltransferase | - |
| LLNCDO702_RS02765 (LLNCDO702_02775) | - | 523200..523754 (-) | 555 | WP_003131507.1 | TIGR00730 family Rossman fold protein | - |
| LLNCDO702_RS02770 (LLNCDO702_02780) | - | 523754..524407 (-) | 654 | WP_003131506.1 | deoxynucleoside kinase | - |
| LLNCDO702_RS02775 (LLNCDO702_02785) | - | 524888..528070 (+) | 3183 | WP_003131504.1 | DNA polymerase III subunit alpha | - |
| LLNCDO702_RS02780 (LLNCDO702_02790) | - | 528101..528754 (-) | 654 | WP_003131502.1 | hemolysin III family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15716.47 Da Isoelectric Point: 5.1972
>NTDB_id=851283 LLNCDO702_RS02505 WP_015967987.1 483608..484033(+) (ssb) [Lactococcus lactis subsp. lactis strain NCDO702]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERISNPASKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERISNPASKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=851283 LLNCDO702_RS02505 WP_015967987.1 483608..484033(+) (ssb) [Lactococcus lactis subsp. lactis strain NCDO702]
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAATTAGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAATTAGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.638 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.731 |
73.759 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
51.456 |
73.05 |
0.376 |