Detailed information NTG0844071

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: QP436_RS08520
• Genome accession: NZ_CP127404
• Coordinates: 1917680..1918090 (-)
• Length: 136 a.a.
• NCBI ID: WP_100553380.1
• Uniprot ID: A0AAW4GH69
• Organism: Stenotrophomonas sp. As-6
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1918184..1930087	1917680..1918090	flank	94

Gene organization within MGE regions

Location: 1917680..1930087

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QP436_RS08520	comP	1917680..1918090 (-)	411	WP_100553380.1	pilin	Machinery gene
QP436_RS08525	-	1918184..1919080 (-)	897	WP_205406021.1	serine hydrolase domain-containing protein	-
QP436_RS08530	-	1919101..1920213 (-)	1113	WP_205406022.1	isoprenylcysteine carboxylmethyltransferase family protein	-
QP436_RS08535	comP	1920384..1920827 (-)	444	WP_100553383.1	pilin	Machinery gene
QP436_RS08540	pilC	1921175..1922434 (+)	1260	WP_205406026.1	type II secretion system F family protein	Machinery gene
QP436_RS08545	-	1922443..1923306 (+)	864	WP_089236602.1	A24 family peptidase	-
QP436_RS08550	coaE	1923318..1923929 (+)	612	WP_180165743.1	dephospho-CoA kinase	-
QP436_RS08555	-	1924029..1924415 (-)	387	WP_100553386.1	hypothetical protein	-
QP436_RS08560	-	1924980..1926350 (-)	1371	WP_100460170.1	HAMP domain-containing sensor histidine kinase	-
QP436_RS08565	-	1926313..1926990 (-)	678	WP_025874286.1	response regulator transcription factor	-
QP436_RS08570	-	1926999..1927472 (-)	474	WP_180165745.1	hypothetical protein	-
QP436_RS08575	-	1927562..1928038 (-)	477	WP_205406023.1	hypothetical protein	-
QP436_RS08580	rimK	1928292..1929170 (-)	879	WP_100553389.1	30S ribosomal protein S6--L-glutamate ligase	-
QP436_RS08585	-	1929265..1929507 (-)	243	WP_180165749.1	hypothetical protein	-
QP436_RS08590	-	1929707..1930087 (-)	381	WP_180165751.1	DUF805 domain-containing protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 14497.86 Da
• Isoelectric Point: 8.1062

>NTDB_id=844071 QP436_RS08520 WP_100553380.1 1917680..1918090(-) (comP) [Stenotrophomonas sp. As-6]
MNRNRGFTLVELMIVVAIIAILAAIALPAYQTYTIRARVSEALVLASYAKVTVTENINNINALDSTSCLGVDDLPAATVN
VQTLTCTGNGVLTMMTTTKAGGVSLTLTPTFRPSDLVRWKCAQVSGDSKYVPAECR

Nucleotide

• Length: 411 bp

>NTDB_id=844071 QP436_RS08520 WP_100553380.1 1917680..1918090(-) (comP) [Stenotrophomonas sp. As-6]
ATGAACAGGAATCGCGGTTTCACACTGGTTGAACTAATGATCGTTGTCGCAATCATCGCAATCCTTGCTGCGATAGCATT
GCCTGCATACCAGACTTACACCATTCGCGCCCGGGTATCGGAGGCATTGGTGCTTGCGTCGTATGCGAAGGTGACGGTTA
CTGAAAACATAAACAACATCAATGCCTTGGACTCTACGTCTTGTTTGGGTGTGGATGATTTGCCCGCAGCGACGGTTAAC
GTTCAGACCCTCACCTGCACGGGGAATGGTGTACTTACCATGATGACGACCACCAAGGCTGGAGGCGTGTCACTGACGTT
GACTCCGACCTTCAGGCCGAGCGACCTGGTTCGCTGGAAATGTGCGCAGGTTTCCGGTGACTCCAAATACGTGCCAGCGG
AATGCCGGTGA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (36-136)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Acinetobacter baylyi ADP1	54.054	100	0.588
pilA	Ralstonia pseudosolanacearum GMI1000	43.827	100	0.522
pilA2	Legionella pneumophila strain ERS1305867	52.239	98.529	0.515
pilA2	Legionella pneumophila str. Paris	51.493	98.529	0.507
pilE	Neisseria gonorrhoeae strain FA1090	38.75	100	0.456
pilE	Neisseria gonorrhoeae MS11	37.58	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40	100	0.426
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.956	100	0.382
pilA	Pseudomonas aeruginosa PAK	33.553	100	0.375
pilA	Haemophilus influenzae 86-028NP	36.567	98.529	0.36