Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QQ998_RS06210 | Genome accession | NZ_CP127397 |
| Coordinates | 1275202..1275477 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain PUBM_2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1275501..1319716 | 1275202..1275477 | flank | 24 |
Gene organization within MGE regions
Location: 1275202..1319716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ998_RS06210 (QQ998_06195) | comGC/cglC | 1275202..1275477 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QQ998_RS06215 (QQ998_06200) | comGD | 1275474..1275917 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| QQ998_RS06220 (QQ998_06205) | - | 1275945..1277093 (-) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| QQ998_RS06225 (QQ998_06210) | - | 1277168..1277497 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| QQ998_RS06230 (QQ998_06215) | - | 1277512..1278276 (-) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QQ998_RS06235 (QQ998_06220) | - | 1278394..1279041 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QQ998_RS06240 (QQ998_06225) | - | 1279046..1279390 (-) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| QQ998_RS06245 (QQ998_06230) | - | 1279681..1279872 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| QQ998_RS06250 (QQ998_06235) | - | 1279878..1280195 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| QQ998_RS06255 (QQ998_06240) | - | 1280234..1280956 (+) | 723 | WP_002364225.1 | Rha family transcriptional regulator | - |
| QQ998_RS06260 (QQ998_06245) | - | 1280996..1281178 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| QQ998_RS06265 (QQ998_06250) | - | 1281231..1281425 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| QQ998_RS06270 (QQ998_06255) | - | 1281416..1281601 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| QQ998_RS06275 (QQ998_06260) | - | 1281645..1281968 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| QQ998_RS06280 (QQ998_06265) | - | 1281968..1282195 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| QQ998_RS06285 (QQ998_06270) | - | 1282293..1283234 (+) | 942 | WP_002384348.1 | YqaJ viral recombinase family protein | - |
| QQ998_RS06290 (QQ998_06275) | - | 1283237..1284127 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| QQ998_RS06295 (QQ998_06280) | - | 1284141..1285108 (+) | 968 | Protein_1183 | Lin1244/Lin1753 domain-containing protein | - |
| QQ998_RS06300 (QQ998_06285) | - | 1285112..1285414 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| QQ998_RS06305 (QQ998_06290) | - | 1285415..1285714 (+) | 300 | WP_002364213.1 | MazG-like family protein | - |
| QQ998_RS06310 (QQ998_06295) | - | 1285732..1286155 (+) | 424 | Protein_1186 | RusA family crossover junction endodeoxyribonuclease | - |
| QQ998_RS06315 | - | 1286434..1286694 (+) | 261 | WP_002357017.1 | hypothetical protein | - |
| QQ998_RS06320 (QQ998_06300) | - | 1287062..1287478 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QQ998_RS06330 (QQ998_06310) | - | 1288009..1288623 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| QQ998_RS06335 (QQ998_06315) | - | 1289340..1290086 (+) | 747 | WP_174090703.1 | DUF5677 domain-containing protein | - |
| QQ998_RS06340 (QQ998_06320) | terS | 1290107..1290910 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| QQ998_RS06345 (QQ998_06325) | - | 1290882..1292171 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| QQ998_RS06350 (QQ998_06330) | - | 1292183..1293670 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| QQ998_RS06355 (QQ998_06335) | - | 1293645..1295402 (+) | 1758 | WP_002384360.1 | head protein | - |
| QQ998_RS06360 (QQ998_06340) | - | 1295399..1295620 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| QQ998_RS06365 (QQ998_06345) | - | 1295685..1296005 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| QQ998_RS06370 (QQ998_06350) | - | 1296223..1296846 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| QQ998_RS06375 (QQ998_06355) | - | 1296860..1297747 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QQ998_RS06380 (QQ998_06360) | - | 1297776..1297958 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| QQ998_RS06385 (QQ998_06365) | - | 1297972..1298316 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| QQ998_RS06390 (QQ998_06370) | - | 1298313..1298681 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| QQ998_RS06395 | - | 1298674..1298757 (+) | 84 | Protein_1202 | HK97 gp10 family phage protein | - |
| QQ998_RS06400 (QQ998_06375) | - | 1298895..1300145 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QQ998_RS06405 (QQ998_06380) | - | 1300499..1300843 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| QQ998_RS06410 (QQ998_06385) | - | 1300846..1301220 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| QQ998_RS06415 (QQ998_06390) | - | 1301221..1302069 (+) | 849 | WP_002384363.1 | major tail protein | - |
| QQ998_RS06420 (QQ998_06395) | gpG | 1302122..1302472 (+) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| QQ998_RS06425 (QQ998_06400) | - | 1302720..1305617 (+) | 2898 | Protein_1208 | tape measure protein | - |
| QQ998_RS06430 (QQ998_06405) | - | 1305607..1306341 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| QQ998_RS06435 (QQ998_06410) | - | 1306323..1309130 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| QQ998_RS06440 (QQ998_06415) | - | 1309149..1310030 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| QQ998_RS06445 (QQ998_06420) | - | 1310023..1310619 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| QQ998_RS06450 (QQ998_06425) | - | 1310616..1310903 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| QQ998_RS06455 (QQ998_06430) | - | 1310903..1311394 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| QQ998_RS06460 (QQ998_06435) | - | 1311408..1311728 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| QQ998_RS06465 (QQ998_06440) | - | 1311730..1311885 (+) | 156 | WP_410497137.1 | XkdX family protein | - |
| QQ998_RS06470 (QQ998_06445) | - | 1311920..1312141 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| QQ998_RS06475 (QQ998_06450) | - | 1312134..1312367 (+) | 234 | WP_002384371.1 | phage holin | - |
| QQ998_RS06480 (QQ998_06455) | - | 1312368..1313609 (+) | 1242 | WP_002384372.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QQ998_RS06485 (QQ998_06460) | - | 1314474..1314674 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QQ998_RS06490 (QQ998_06465) | - | 1314746..1315018 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| QQ998_RS06500 (QQ998_06475) | hemH | 1315734..1316675 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QQ998_RS06505 (QQ998_06480) | - | 1317477..1317803 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QQ998_RS06510 (QQ998_06485) | comGF | 1317793..1318227 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QQ998_RS06515 (QQ998_06490) | comGG | 1318227..1318580 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QQ998_RS06520 (QQ998_06495) | - | 1318709..1319716 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=844011 QQ998_RS06210 WP_002364235.1 1275202..1275477(+) (comGC/cglC) [Enterococcus faecalis strain PUBM_2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=844011 QQ998_RS06210 WP_002364235.1 1275202..1275477(+) (comGC/cglC) [Enterococcus faecalis strain PUBM_2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |