Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QQS48_RS08335 | Genome accession | NZ_CP127177 |
| Coordinates | 1724040..1724315 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 90_2023 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1685066..1724016 | 1724040..1724315 | flank | 24 |
Gene organization within MGE regions
Location: 1685066..1724315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQS48_RS08045 (QQS48_08045) | - | 1685066..1686073 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QQS48_RS08050 (QQS48_08050) | comGG | 1686202..1686555 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| QQS48_RS08055 (QQS48_08055) | comGF | 1686555..1686989 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QQS48_RS08060 (QQS48_08060) | - | 1686979..1687380 (-) | 402 | WP_002397440.1 | type II secretion system protein | - |
| QQS48_RS08065 (QQS48_08065) | - | 1687501..1687986 (-) | 486 | WP_174084474.1 | hypothetical protein | - |
| QQS48_RS08070 (QQS48_08070) | - | 1688392..1688835 (-) | 444 | WP_126266804.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QQS48_RS08075 (QQS48_08075) | - | 1688828..1689655 (-) | 828 | WP_164549170.1 | DUF3800 domain-containing protein | - |
| QQS48_RS08080 (QQS48_08080) | - | 1689805..1691064 (-) | 1260 | WP_267570864.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QQS48_RS08085 (QQS48_08085) | - | 1691065..1691460 (-) | 396 | WP_267570863.1 | phage holin family protein | - |
| QQS48_RS08090 (QQS48_08090) | - | 1691490..1692707 (-) | 1218 | WP_267570862.1 | glycerophosphodiester phosphodiesterase | - |
| QQS48_RS08095 (QQS48_08095) | - | 1692707..1693024 (-) | 318 | WP_267570861.1 | hypothetical protein | - |
| QQS48_RS08100 (QQS48_08100) | - | 1693017..1693331 (-) | 315 | WP_280196307.1 | hypothetical protein | - |
| QQS48_RS08105 (QQS48_08105) | - | 1693331..1694233 (-) | 903 | WP_174084357.1 | phage baseplate upper protein | - |
| QQS48_RS08110 (QQS48_08110) | - | 1694250..1697054 (-) | 2805 | WP_174084356.1 | phage tail tip lysozyme | - |
| QQS48_RS08115 (QQS48_08115) | - | 1697051..1697764 (-) | 714 | WP_174084355.1 | phage tail protein | - |
| QQS48_RS08120 (QQS48_08120) | - | 1697761..1700064 (-) | 2304 | WP_174084354.1 | phage tail tape measure protein | - |
| QQS48_RS08125 (QQS48_08125) | - | 1700256..1700711 (-) | 456 | WP_174084353.1 | hypothetical protein | - |
| QQS48_RS08130 (QQS48_08130) | - | 1700711..1701358 (-) | 648 | WP_002393025.1 | tail protein | - |
| QQS48_RS08135 (QQS48_08135) | - | 1701355..1701717 (-) | 363 | WP_016634652.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QQS48_RS08140 (QQS48_08140) | - | 1701707..1702045 (-) | 339 | WP_002406253.1 | hypothetical protein | - |
| QQS48_RS08145 (QQS48_08145) | - | 1702035..1702355 (-) | 321 | WP_267570859.1 | phage head closure protein | - |
| QQS48_RS08150 (QQS48_08150) | - | 1702339..1702608 (-) | 270 | WP_285534243.1 | phage gp6-like head-tail connector protein | - |
| QQS48_RS08155 (QQS48_08155) | - | 1702750..1703928 (-) | 1179 | WP_174084350.1 | phage major capsid protein | - |
| QQS48_RS08160 (QQS48_08160) | - | 1703925..1704599 (-) | 675 | WP_174084349.1 | head maturation protease, ClpP-related | - |
| QQS48_RS08165 (QQS48_08165) | - | 1704580..1705761 (-) | 1182 | WP_174084348.1 | phage portal protein | - |
| QQS48_RS08170 (QQS48_08170) | - | 1705776..1707467 (-) | 1692 | WP_262120590.1 | terminase TerL endonuclease subunit | - |
| QQS48_RS08175 (QQS48_08175) | - | 1707469..1707831 (-) | 363 | WP_104876160.1 | hypothetical protein | - |
| QQS48_RS08185 (QQS48_08185) | - | 1709535..1709672 (+) | 138 | WP_010773976.1 | hypothetical protein | - |
| QQS48_RS08190 (QQS48_08190) | - | 1709708..1709971 (-) | 264 | WP_174084463.1 | hypothetical protein | - |
| QQS48_RS08195 (QQS48_08195) | - | 1710324..1710791 (-) | 468 | WP_002380819.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QQS48_RS08200 (QQS48_08200) | - | 1710976..1711200 (-) | 225 | WP_016632373.1 | hypothetical protein | - |
| QQS48_RS08205 (QQS48_08205) | - | 1711383..1711931 (-) | 549 | WP_100966712.1 | DUF1642 domain-containing protein | - |
| QQS48_RS08210 (QQS48_08210) | - | 1711924..1712091 (-) | 168 | WP_048948834.1 | hypothetical protein | - |
| QQS48_RS08215 (QQS48_08215) | - | 1712088..1712498 (-) | 411 | WP_100966713.1 | YopX family protein | - |
| QQS48_RS08220 (QQS48_08220) | - | 1712532..1712843 (-) | 312 | WP_002393129.1 | hypothetical protein | - |
| QQS48_RS08225 (QQS48_08225) | - | 1712864..1713184 (-) | 321 | WP_016024806.1 | hypothetical protein | - |
| QQS48_RS08230 (QQS48_08230) | - | 1713186..1713650 (-) | 465 | Protein_1598 | class I SAM-dependent methyltransferase | - |
| QQS48_RS08235 (QQS48_08235) | - | 1713707..1713934 (-) | 228 | WP_002389214.1 | hypothetical protein | - |
| QQS48_RS08240 (QQS48_08240) | - | 1714062..1714586 (-) | 525 | WP_010711643.1 | hypothetical protein | - |
| QQS48_RS08245 (QQS48_08245) | - | 1714590..1715522 (-) | 933 | WP_280196305.1 | phage replisome organizer N-terminal domain-containing protein | - |
| QQS48_RS08250 (QQS48_08250) | - | 1715527..1716207 (-) | 681 | WP_002389197.1 | putative HNHc nuclease | - |
| QQS48_RS08255 (QQS48_08255) | - | 1716204..1717142 (-) | 939 | WP_002410850.1 | DUF1351 domain-containing protein | - |
| QQS48_RS08260 (QQS48_08260) | - | 1717127..1717804 (-) | 678 | WP_002389124.1 | ERF family protein | - |
| QQS48_RS08265 (QQS48_08265) | - | 1717805..1718041 (-) | 237 | WP_002389004.1 | hypothetical protein | - |
| QQS48_RS08270 (QQS48_08270) | - | 1718098..1718253 (-) | 156 | WP_002389151.1 | hypothetical protein | - |
| QQS48_RS08275 (QQS48_08275) | - | 1718418..1718603 (+) | 186 | WP_025188165.1 | DUF1508 domain-containing protein | - |
| QQS48_RS08280 (QQS48_08280) | - | 1718768..1718908 (-) | 141 | WP_280196304.1 | hypothetical protein | - |
| QQS48_RS08285 (QQS48_08285) | - | 1718920..1719111 (-) | 192 | WP_236547317.1 | hypothetical protein | - |
| QQS48_RS08290 (QQS48_08290) | - | 1719122..1719307 (-) | 186 | WP_033598023.1 | hypothetical protein | - |
| QQS48_RS08295 (QQS48_08295) | - | 1719318..1720031 (-) | 714 | WP_267570857.1 | Rha family transcriptional regulator | - |
| QQS48_RS08300 (QQS48_08300) | - | 1720070..1720381 (-) | 312 | WP_280196303.1 | hypothetical protein | - |
| QQS48_RS08305 (QQS48_08305) | - | 1720392..1720568 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QQS48_RS08310 (QQS48_08310) | - | 1720877..1721200 (+) | 324 | WP_010826721.1 | helix-turn-helix transcriptional regulator | - |
| QQS48_RS08315 (QQS48_08315) | - | 1721218..1721562 (+) | 345 | WP_267570856.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QQS48_RS08320 (QQS48_08320) | - | 1721596..1722324 (+) | 729 | WP_126266796.1 | potassium channel family protein | - |
| QQS48_RS08325 (QQS48_08325) | - | 1722424..1723572 (+) | 1149 | WP_010711674.1 | site-specific integrase | - |
| QQS48_RS08330 (QQS48_08330) | comGD | 1723609..1724043 (-) | 435 | Protein_1618 | competence type IV pilus minor pilin ComGD | - |
| QQS48_RS08335 (QQS48_08335) | comGC/cglC | 1724040..1724315 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=842378 QQS48_RS08335 WP_002356991.1 1724040..1724315(-) (comGC/cglC) [Enterococcus faecalis strain 90_2023]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=842378 QQS48_RS08335 WP_002356991.1 1724040..1724315(-) (comGC/cglC) [Enterococcus faecalis strain 90_2023]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |