Detailed information NTG0842378

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: QQS48_RS08335
• Genome accession: NZ_CP127177
• Coordinates: 1724040..1724315 (-)
• Length: 91 a.a.
• NCBI ID: WP_002356991.1
• Uniprot ID: A0A1B4XPV0
• Organism: Enterococcus faecalis strain 90_2023
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1719040..1729315

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QQS48_RS08290 (QQS48_08290)	-	1719122..1719307 (-)	186	WP_033598023.1	hypothetical protein	-
QQS48_RS08295 (QQS48_08295)	-	1719318..1720031 (-)	714	WP_267570857.1	Rha family transcriptional regulator	-
QQS48_RS08300 (QQS48_08300)	-	1720070..1720381 (-)	312	WP_280196303.1	hypothetical protein	-
QQS48_RS08305 (QQS48_08305)	-	1720392..1720568 (-)	177	WP_002364354.1	helix-turn-helix transcriptional regulator	-
QQS48_RS08310 (QQS48_08310)	-	1720877..1721200 (+)	324	WP_010826721.1	helix-turn-helix transcriptional regulator	-
QQS48_RS08315 (QQS48_08315)	-	1721218..1721562 (+)	345	WP_267570856.1	ImmA/IrrE family metallo-endopeptidase	-
QQS48_RS08320 (QQS48_08320)	-	1721596..1722324 (+)	729	WP_126266796.1	potassium channel family protein	-
QQS48_RS08325 (QQS48_08325)	-	1722424..1723572 (+)	1149	WP_010711674.1	site-specific integrase	-
QQS48_RS08330 (QQS48_08330)	comGD	1723609..1724043 (-)	435	Protein_1618	competence type IV pilus minor pilin ComGD	-
QQS48_RS08335 (QQS48_08335)	comGC/cglC	1724040..1724315 (-)	276	WP_002356991.1	competence type IV pilus major pilin ComGC	Machinery gene
QQS48_RS08340 (QQS48_08340)	comGB	1724315..1725361 (-)	1047	WP_033786346.1	competence type IV pilus assembly protein ComGB	-
QQS48_RS08345 (QQS48_08345)	comGA	1725321..1726286 (-)	966	WP_280196293.1	competence type IV pilus ATPase ComGA	-
QQS48_RS08350 (QQS48_08350)	-	1726527..1727855 (-)	1329	WP_002360022.1	amino acid permease	-
QQS48_RS08355 (QQS48_08355)	rlmN	1728145..1729218 (-)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.41 Da
• Isoelectric Point: 9.3192

>NTDB_id=842378 QQS48_RS08335 WP_002356991.1 1724040..1724315(-) (comGC/cglC) [Enterococcus faecalis strain 90_2023]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=842378 QQS48_RS08335 WP_002356991.1 1724040..1724315(-) (comGC/cglC) [Enterococcus faecalis strain 90_2023]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	46.835	86.813	0.407
comGC	Staphylococcus aureus N315	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396