Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LL303_RS10910 | Genome accession | NZ_CP126467 |
| Coordinates | 2143814..2144239 (-) | Length | 141 a.a. |
| NCBI ID | WP_124156026.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain 303 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2106024..2155715 | 2143814..2144239 | within | 0 |
Gene organization within MGE regions
Location: 2106024..2155715
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL303_RS10650 (LL303_10625) | pknB | 2106024..2107907 (-) | 1884 | WP_003130801.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| LL303_RS10655 (LL303_10630) | - | 2107907..2108683 (-) | 777 | WP_003130802.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LL303_RS10660 (LL303_10635) | rsmB | 2108764..2110038 (-) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LL303_RS10670 (LL303_10645) | - | 2111160..2111939 (-) | 780 | WP_124156035.1 | peptidoglycan amidohydrolase family protein | - |
| LL303_RS10675 (LL303_10650) | - | 2111939..2112238 (-) | 300 | WP_010905918.1 | phage holin | - |
| LL303_RS10680 (LL303_10655) | - | 2112251..2112601 (-) | 351 | WP_095348788.1 | hypothetical protein | - |
| LL303_RS10685 (LL303_10660) | - | 2112614..2112835 (-) | 222 | WP_138428072.1 | hypothetical protein | - |
| LL303_RS10690 (LL303_10665) | - | 2112854..2117134 (-) | 4281 | WP_138428097.1 | hypothetical protein | - |
| LL303_RS10695 (LL303_10670) | - | 2117134..2118708 (-) | 1575 | WP_095350684.1 | distal tail protein Dit | - |
| LL303_RS10700 (LL303_10675) | - | 2118708..2123636 (-) | 4929 | WP_095348707.1 | phage tail tape measure protein | - |
| LL303_RS10705 (LL303_10680) | - | 2123861..2124277 (-) | 417 | WP_095348708.1 | phage tail assembly chaperone | - |
| LL303_RS10710 (LL303_10685) | - | 2124422..2125015 (-) | 594 | WP_095348709.1 | phage tail protein | - |
| LL303_RS10715 (LL303_10690) | - | 2125046..2125441 (-) | 396 | WP_002819790.1 | DUF806 family protein | - |
| LL303_RS10720 (LL303_10695) | - | 2125438..2125944 (-) | 507 | WP_002819791.1 | HK97 gp10 family phage protein | - |
| LL303_RS10725 (LL303_10700) | - | 2125946..2126296 (-) | 351 | WP_095348710.1 | phage head closure protein | - |
| LL303_RS10730 (LL303_10705) | - | 2126271..2126594 (-) | 324 | WP_095348711.1 | head-tail connector protein | - |
| LL303_RS10735 (LL303_10710) | - | 2126610..2127836 (-) | 1227 | WP_095348712.1 | phage major capsid protein | - |
| LL303_RS10740 (LL303_10715) | - | 2127848..2128552 (-) | 705 | WP_249357290.1 | head maturation protease, ClpP-related | - |
| LL303_RS10745 (LL303_10720) | - | 2128598..2129776 (-) | 1179 | WP_095348714.1 | phage portal protein | - |
| LL303_RS10750 (LL303_10725) | - | 2129773..2129991 (-) | 219 | WP_015971023.1 | DUF1056 family protein | - |
| LL303_RS10755 (LL303_10730) | - | 2129960..2131870 (-) | 1911 | WP_002819799.1 | terminase large subunit | - |
| LL303_RS10760 (LL303_10735) | - | 2131860..2132315 (-) | 456 | WP_015971021.1 | phage terminase small subunit P27 family | - |
| LL303_RS10765 (LL303_10740) | - | 2132443..2132961 (-) | 519 | WP_333731559.1 | HNH endonuclease | - |
| LL303_RS10770 (LL303_10745) | - | 2132963..2133184 (-) | 222 | WP_023189038.1 | hypothetical protein | - |
| LL303_RS10780 (LL303_10755) | - | 2133745..2134167 (-) | 423 | WP_015966900.1 | RinA family protein | - |
| LL303_RS10785 (LL303_10760) | - | 2134244..2134537 (-) | 294 | WP_095348760.1 | DUF1359 domain-containing protein | - |
| LL303_RS10790 (LL303_10765) | - | 2134916..2135098 (-) | 183 | WP_010905705.1 | hypothetical protein | - |
| LL303_RS10795 (LL303_10770) | - | 2135159..2135311 (-) | 153 | WP_249357288.1 | hypothetical protein | - |
| LL303_RS10800 (LL303_10775) | - | 2135308..2135493 (-) | 186 | WP_014570738.1 | hypothetical protein | - |
| LL303_RS10805 (LL303_10780) | - | 2135529..2135690 (-) | 162 | WP_023164357.1 | hypothetical protein | - |
| LL303_RS10810 (LL303_10785) | - | 2135690..2135854 (-) | 165 | WP_095346103.1 | DUF1660 domain-containing protein | - |
| LL303_RS10815 (LL303_10790) | - | 2135851..2135994 (-) | 144 | WP_010905362.1 | hypothetical protein | - |
| LL303_RS10820 (LL303_10795) | - | 2136041..2136235 (-) | 195 | WP_023164635.1 | hypothetical protein | - |
| LL303_RS10825 (LL303_10800) | - | 2136252..2136902 (-) | 651 | WP_095348765.1 | hypothetical protein | - |
| LL303_RS10830 (LL303_10805) | - | 2136889..2137179 (-) | 291 | WP_171031474.1 | hypothetical protein | - |
| LL303_RS10835 (LL303_10810) | - | 2137172..2137492 (-) | 321 | WP_095348766.1 | hypothetical protein | - |
| LL303_RS10840 (LL303_10815) | - | 2137489..2138052 (-) | 564 | WP_249357287.1 | hypothetical protein | - |
| LL303_RS10845 (LL303_10820) | - | 2138055..2138474 (-) | 420 | WP_015966810.1 | dUTP diphosphatase | - |
| LL303_RS10850 (LL303_10825) | - | 2138471..2139127 (-) | 657 | WP_249357297.1 | DUF1642 domain-containing protein | - |
| LL303_RS10855 | - | 2139120..2139272 (-) | 153 | WP_015967991.1 | hypothetical protein | - |
| LL303_RS10860 (LL303_10830) | - | 2139265..2139471 (-) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LL303_RS10865 (LL303_10835) | - | 2139472..2139732 (-) | 261 | WP_011676533.1 | hypothetical protein | - |
| LL303_RS10870 (LL303_10840) | - | 2139743..2140105 (-) | 363 | WP_095348620.1 | DUF658 family protein | - |
| LL303_RS10875 (LL303_10845) | - | 2140080..2140244 (-) | 165 | WP_021722234.1 | hypothetical protein | - |
| LL303_RS10880 (LL303_10850) | - | 2140355..2140594 (-) | 240 | WP_095348621.1 | DUF1031 family protein | - |
| LL303_RS10885 (LL303_10855) | - | 2140587..2141402 (-) | 816 | WP_095348622.1 | site-specific DNA-methyltransferase | - |
| LL303_RS10890 (LL303_10860) | - | 2141407..2141796 (-) | 390 | WP_081196274.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LL303_RS10895 (LL303_10865) | - | 2141786..2141950 (-) | 165 | WP_039115263.1 | hypothetical protein | - |
| LL303_RS10900 (LL303_10870) | - | 2141959..2142849 (-) | 891 | WP_023164371.1 | ATP-binding protein | - |
| LL303_RS10905 (LL303_10875) | - | 2142859..2143689 (-) | 831 | WP_095348763.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LL303_RS10910 (LL303_10880) | ssb | 2143814..2144239 (-) | 426 | WP_124156026.1 | single-stranded DNA-binding protein | Machinery gene |
| LL303_RS10915 (LL303_10885) | - | 2144232..2144990 (-) | 759 | WP_124156027.1 | Rad52/Rad22 family DNA repair protein | - |
| LL303_RS10920 (LL303_10890) | - | 2144999..2145394 (-) | 396 | WP_095348642.1 | hypothetical protein | - |
| LL303_RS10925 (LL303_10895) | - | 2145509..2145724 (-) | 216 | WP_010905687.1 | DUF1408 domain-containing protein | - |
| LL303_RS10930 (LL303_10900) | - | 2145829..2146206 (+) | 378 | WP_095348636.1 | DUF2513 domain-containing protein | - |
| LL303_RS10935 (LL303_10905) | - | 2146199..2146582 (-) | 384 | WP_249357286.1 | hypothetical protein | - |
| LL303_RS10940 (LL303_10910) | - | 2146619..2146852 (-) | 234 | WP_095348644.1 | hypothetical protein | - |
| LL303_RS10945 (LL303_10915) | - | 2146947..2147216 (-) | 270 | WP_023164536.1 | hypothetical protein | - |
| LL303_RS10950 (LL303_10920) | - | 2147230..2147976 (-) | 747 | WP_095348637.1 | phage antirepressor | - |
| LL303_RS10955 (LL303_10925) | - | 2147988..2148233 (-) | 246 | WP_080513132.1 | helix-turn-helix transcriptional regulator | - |
| LL303_RS10960 (LL303_10930) | - | 2148332..2148694 (+) | 363 | WP_063283805.1 | MarR family transcriptional regulator | - |
| LL303_RS10965 (LL303_10935) | - | 2148927..2149619 (+) | 693 | WP_032398927.1 | hypothetical protein | - |
| LL303_RS10970 (LL303_10940) | - | 2149643..2149813 (-) | 171 | WP_171031473.1 | putative transcriptional regulator | - |
| LL303_RS10975 (LL303_10945) | - | 2150107..2150688 (+) | 582 | WP_095348639.1 | helix-turn-helix domain-containing protein | - |
| LL303_RS10980 (LL303_10950) | - | 2150694..2151128 (+) | 435 | WP_095348640.1 | zinc peptidase | - |
| LL303_RS10985 (LL303_10955) | - | 2151142..2151477 (+) | 336 | WP_014570766.1 | hypothetical protein | - |
| LL303_RS10990 (LL303_10960) | - | 2151544..2152725 (+) | 1182 | WP_095348641.1 | site-specific integrase | - |
| LL303_RS10995 (LL303_10965) | - | 2153025..2153531 (-) | 507 | WP_023164544.1 | Asp23/Gls24 family envelope stress response protein | - |
| LL303_RS11000 (LL303_10970) | - | 2153552..2153740 (-) | 189 | WP_033899826.1 | DUF2273 domain-containing protein | - |
| LL303_RS11005 (LL303_10975) | amaP | 2153751..2154311 (-) | 561 | WP_010906186.1 | alkaline shock response membrane anchor protein AmaP | - |
| LL303_RS11010 (LL303_10980) | - | 2154339..2154581 (-) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| LL303_RS11015 (LL303_10985) | fmt | 2154756..2155715 (-) | 960 | WP_010906187.1 | methionyl-tRNA formyltransferase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15644.36 Da Isoelectric Point: 5.1972
>NTDB_id=838038 LL303_RS10910 WP_124156026.1 2143814..2144239(-) (ssb) [Lactococcus lactis subsp. lactis strain 303]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYVTEVIANNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYVTEVIANNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=838038 LL303_RS10910 WP_124156026.1 2143814..2144239(-) (ssb) [Lactococcus lactis subsp. lactis strain 303]
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGTCAACGAGTTTATGTAACAGAAGTCATTGCAAACAATTTCCAAGTACTTGAAAAAAGCAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGTCAACGAGTTTATGTAACAGAAGTCATTGCAAACAATTTCCAAGTACTTGAAAAAAGCAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.638 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.716 |
100 |
0.397 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |