Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LL303_RS07785 | Genome accession | NZ_CP126467 |
| Coordinates | 1513103..1513528 (-) | Length | 141 a.a. |
| NCBI ID | WP_124156030.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain 303 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1484144..1522954 | 1513103..1513528 | within | 0 |
Gene organization within MGE regions
Location: 1484144..1522954
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL303_RS07590 (LL303_07575) | - | 1484144..1484674 (-) | 531 | WP_029344027.1 | hypothetical protein | - |
| LL303_RS07595 | - | 1485026..1485226 (+) | 201 | Protein_1473 | site-specific integrase | - |
| LL303_RS07605 (LL303_07585) | - | 1486151..1486930 (-) | 780 | WP_333731542.1 | peptidoglycan amidohydrolase family protein | - |
| LL303_RS07610 (LL303_07590) | - | 1486930..1487217 (-) | 288 | WP_023164507.1 | phage holin | - |
| LL303_RS07615 (LL303_07595) | - | 1487231..1487455 (-) | 225 | WP_011676503.1 | hemolysin XhlA family protein | - |
| LL303_RS07620 (LL303_07600) | - | 1487468..1487698 (-) | 231 | WP_023164509.1 | hypothetical protein | - |
| LL303_RS07625 (LL303_07605) | - | 1487712..1492265 (-) | 4554 | WP_249357234.1 | serine/threonine protein phosphatase | - |
| LL303_RS07630 (LL303_07610) | - | 1492265..1493791 (-) | 1527 | WP_095348678.1 | distal tail protein Dit | - |
| LL303_RS07635 (LL303_07615) | - | 1493788..1497681 (-) | 3894 | WP_058220343.1 | phage tail tape measure protein | - |
| LL303_RS07640 (LL303_07620) | - | 1497759..1498322 (-) | 564 | WP_095348677.1 | DUF4177 domain-containing protein | - |
| LL303_RS07645 (LL303_07625) | - | 1498394..1498606 (-) | 213 | WP_023189087.1 | hypothetical protein | - |
| LL303_RS07650 (LL303_07630) | gpG | 1498603..1498920 (-) | 318 | WP_023189088.1 | phage tail assembly chaperone G | - |
| LL303_RS07655 (LL303_07635) | - | 1498926..1499513 (-) | 588 | WP_058220473.1 | major tail protein | - |
| LL303_RS07660 (LL303_07640) | - | 1499531..1499920 (-) | 390 | WP_031560795.1 | hypothetical protein | - |
| LL303_RS07665 (LL303_07645) | - | 1499917..1500321 (-) | 405 | WP_023189091.1 | HK97 gp10 family phage protein | - |
| LL303_RS07670 (LL303_07650) | - | 1500314..1500700 (-) | 387 | WP_042748154.1 | hypothetical protein | - |
| LL303_RS07675 (LL303_07655) | - | 1500666..1500998 (-) | 333 | WP_042748153.1 | hypothetical protein | - |
| LL303_RS07680 (LL303_07660) | - | 1501047..1502168 (-) | 1122 | WP_095348676.1 | phage major capsid protein | - |
| LL303_RS07685 (LL303_07665) | - | 1502168..1502935 (-) | 768 | WP_163688067.1 | head maturation protease, ClpP-related | - |
| LL303_RS07690 (LL303_07670) | - | 1502922..1504115 (-) | 1194 | WP_095345912.1 | phage portal protein | - |
| LL303_RS07695 (LL303_07675) | - | 1504239..1504475 (-) | 237 | WP_095345914.1 | hypothetical protein | - |
| LL303_RS07700 (LL303_07680) | - | 1504840..1506579 (-) | 1740 | WP_058220479.1 | terminase large subunit domain-containing protein | - |
| LL303_RS07705 (LL303_07685) | - | 1506576..1507127 (-) | 552 | WP_240342270.1 | P27 family phage terminase small subunit | - |
| LL303_RS07710 (LL303_07690) | - | 1507307..1507612 (-) | 306 | WP_058220480.1 | HNH endonuclease | - |
| LL303_RS07715 (LL303_07695) | - | 1507661..1507960 (-) | 300 | WP_023189100.1 | hypothetical protein | - |
| LL303_RS07720 (LL303_07700) | - | 1508513..1508674 (-) | 162 | WP_023164357.1 | hypothetical protein | - |
| LL303_RS07725 (LL303_07705) | - | 1508674..1508838 (-) | 165 | WP_095346103.1 | DUF1660 domain-containing protein | - |
| LL303_RS07730 (LL303_07710) | - | 1508835..1508978 (-) | 144 | WP_010905946.1 | hypothetical protein | - |
| LL303_RS07735 (LL303_07715) | - | 1508997..1509332 (-) | 336 | WP_124156031.1 | DUF1140 family protein | - |
| LL303_RS07740 (LL303_07720) | - | 1509335..1509754 (-) | 420 | WP_023164525.1 | dUTP diphosphatase | - |
| LL303_RS07745 (LL303_07725) | - | 1509751..1510314 (-) | 564 | WP_095348752.1 | DUF1642 domain-containing protein | - |
| LL303_RS07750 (LL303_07730) | - | 1510311..1510700 (-) | 390 | WP_095348753.1 | YopX family protein | - |
| LL303_RS07755 (LL303_07735) | - | 1510711..1511073 (-) | 363 | WP_031559938.1 | DUF658 family protein | - |
| LL303_RS07760 (LL303_07740) | - | 1511048..1511212 (-) | 165 | WP_032947747.1 | hypothetical protein | - |
| LL303_RS07765 (LL303_07745) | - | 1511320..1511559 (-) | 240 | WP_011834786.1 | DUF1031 domain-containing protein | - |
| LL303_RS07770 (LL303_07750) | - | 1511560..1511979 (-) | 420 | WP_021165554.1 | hypothetical protein | - |
| LL303_RS07775 (LL303_07755) | - | 1511969..1512190 (-) | 222 | WP_021211208.1 | hypothetical protein | - |
| LL303_RS07780 (LL303_07760) | - | 1512171..1512974 (-) | 804 | WP_095348754.1 | helix-turn-helix domain-containing protein | - |
| LL303_RS07785 (LL303_07765) | ssb | 1513103..1513528 (-) | 426 | WP_124156030.1 | single-stranded DNA-binding protein | Machinery gene |
| LL303_RS07790 (LL303_07770) | - | 1513521..1514279 (-) | 759 | WP_015967986.1 | Rad52/Rad22 family DNA repair protein | - |
| LL303_RS07795 (LL303_07775) | - | 1514288..1514806 (-) | 519 | WP_010905688.1 | host-nuclease inhibitor Gam family protein | - |
| LL303_RS07800 (LL303_07780) | - | 1514922..1515137 (-) | 216 | WP_023189642.1 | DUF1408 domain-containing protein | - |
| LL303_RS07805 (LL303_07785) | - | 1515240..1515515 (+) | 276 | WP_023349243.1 | hypothetical protein | - |
| LL303_RS07810 (LL303_07790) | - | 1515512..1515706 (-) | 195 | WP_058220423.1 | hypothetical protein | - |
| LL303_RS07815 (LL303_07795) | - | 1515849..1516139 (-) | 291 | WP_095348557.1 | hypothetical protein | - |
| LL303_RS07820 (LL303_07800) | - | 1516152..1516904 (-) | 753 | WP_095348556.1 | phage antirepressor KilAC domain-containing protein | - |
| LL303_RS07825 (LL303_07805) | - | 1516916..1517155 (-) | 240 | WP_023349341.1 | helix-turn-helix transcriptional regulator | - |
| LL303_RS07830 (LL303_07810) | - | 1517180..1517389 (-) | 210 | WP_124175657.1 | hypothetical protein | - |
| LL303_RS07835 (LL303_07815) | - | 1517544..1518236 (+) | 693 | WP_095348555.1 | hypothetical protein | - |
| LL303_RS07840 (LL303_07820) | - | 1518229..1518462 (-) | 234 | WP_095348554.1 | hypothetical protein | - |
| LL303_RS07845 (LL303_07825) | - | 1518726..1519244 (+) | 519 | WP_095348553.1 | helix-turn-helix domain-containing protein | - |
| LL303_RS07850 (LL303_07830) | - | 1519254..1519841 (+) | 588 | WP_095348552.1 | hypothetical protein | - |
| LL303_RS07855 (LL303_07835) | - | 1519906..1520712 (+) | 807 | WP_249357245.1 | hypothetical protein | - |
| LL303_RS07860 (LL303_07840) | - | 1520835..1521914 (+) | 1080 | WP_095348551.1 | site-specific integrase | - |
| LL303_RS07870 (LL303_07850) | - | 1522619..1522954 (-) | 336 | WP_003130477.1 | putative DNA-binding protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15729.51 Da Isoelectric Point: 5.1972
>NTDB_id=838027 LL303_RS07785 WP_124156030.1 1513103..1513528(-) (ssb) [Lactococcus lactis subsp. lactis strain 303]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDLMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDLMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=838027 LL303_RS07785 WP_124156030.1 1513103..1513528(-) (ssb) [Lactococcus lactis subsp. lactis strain 303]
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCTAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCTAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.455 |
100 |
0.461 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.461 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.39 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.755 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.755 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.755 |
100 |
0.454 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.755 |
100 |
0.454 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |